Coccidioides posadasii: CPC735_001440 Help Entry CPC735_001440     CDS       T01332                                  Name (RefSeq) REX1 DNA Repair family protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism cpw  Coccidioides posadasii Pathway cpw03022   Basal transcription factors cpw03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cpw00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     CPC735_001440   09124 Replication and repair    03420 Nucleotide excision repair     CPC735_001440  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cpw03021]     CPC735_001440    03400 DNA repair and recombination proteins [BR:cpw03400]     CPC735_001440 Transcription machinery [BR:cpw03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      CPC735_001440 DNA repair and recombination proteins [BR:cpw03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      CPC735_001440 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  9692403 NCBI-ProteinID:  XP_003066944 UniProt:  C5PE66 LinkDB All DBs Position Unknown AA seq 72 aa AA seqDB search MPRAVKGVLIECDPSVKAIILKYDEERHDYIVEDLDDDRHLVVKESQLQNLKMRLSRELD EKVMQPEESESE NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgccgcgtgcagtcaaaggagtactgatcgaatgcgatccatccgtcaaggccatcatc ctcaaatacgatgaggagagacacgattacattgttgaggacctggacgatgacaggcac ctggtcgtcaaggaaagtcaactccagaacttgaagatgcgcctgagtcgggagcttgat gagaaggtcatgcaaccagaggaatcggagtccgagtga

DBGET integrated database retrieval system