Lachnoclostridium phytofermentans: Cphy_2446 Help Entry Cphy_2446         CDS       T00619                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cpy  Lachnoclostridium phytofermentans Pathway cpy01100   Metabolic pathways cpy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cpy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Cphy_2446    00074 Mycolic acid biosynthesis     Cphy_2446   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Cphy_2446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Baculo_Y142 Motif Other DBs NCBI-ProteinID:  ABX42807 UniProt:  A9KLR3 LinkDB All DBs Position complement(3003416..3003646) Genome browser AA seq 76 aa AA seqDB search MEFEKLQKIIGEVLNIETEEITMETTFIDDLGADSLDIYQIIMGIEEEFDIEIPNEEAEN IVTVADAVEQIKNALE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaatttgaaaagttacagaaaattatcggtgaagtattaaacattgaaacagaggaa atcacaatggagacaacattcattgatgacttaggagcagattctttggatatctaccag attattatgggaatcgaagaagagttcgatatcgagattccaaacgaagaggcagagaat attgtaacggttgcggatgcagttgaacaaatcaagaatgcattggaataa

DBGET integrated database retrieval system