KEGG   Corynebacterium pyruviciproducens: CYJ47_02460
Entry
CYJ47_02460       CDS       T09618                                 
Symbol
kdpB
Name
(GenBank) potassium-transporting ATPase subunit KdpB
  KO
K01547  potassium-transporting ATPase ATP-binding subunit [EC:7.2.2.6]
Organism
cpyr  Corynebacterium pyruviciproducens
Pathway
cpyr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpyr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CYJ47_02460 (kdpB)
Enzymes [BR:cpyr01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.6  P-type K+ transporter
     CYJ47_02460 (kdpB)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase HAD Hydrolase_3 YesK Mur_ligase_C
Other DBs
NCBI-ProteinID: WOT02656
UniProt: A0AAF0YW73
LinkDB
Position
507446..509512
AA seq 688 aa
MTLKTTADPASQGSAKPAAQASSLQLAVKTLPRKLSPVAQARNPVMFVVWVGAFLTTVWS
LFSPSVYSWTVTVWLWFTIAFAAFAEAYAEGRGKAQADSLRAVRDDATANLVLADGSTET
IAASELKKGDEVIVVAGETIPGDGDVVQGAATVDESAITGESAPVVREAGGDRCAVTGGT
VVLSDQIRVKITAEPGSTFVDKMIGLVEGAQRRKTPNEIALSILLSTLTILFLVAVTALA
PMGGFTGAKLEPLSLVALLVCLIPTTIAALLSAVGIAGMNRLVEHNVLATSGRAVEAAGD
VATLLMDKTGTITFGNRQATGLTVADGVDEHYAAEAARVASIADETPEGRSIVEWLTATY
NITDDITDEVKTANVVPFTATTRMSGIDVGGRFLRKGAGDAVKAWVTEAGGTWPEHISMA
VHEIAQSGGTPLPVAEETSDGSRRVIGVLQLTDVVKPGMAERFAELREMGIRTVMVTGDN
PLTAAAIAEEAGVDDFIAEATPEDKLARIREEQASGRMVAMTGDGTNDAPALAQADVGVA
MNTGTSAAKEAANMVDLDSDPTKLIDIVRIGKQLLITRGALTTFSLANDLAKYFAILPAL
FAEKLPHLSALNIMHLHSPQSAIVSAVIFNALIIVALIPLALKGVRYKPASAAKLLRRNL
GIWGIGGVITPFIGIWLIDLVVSLLPGM
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgacactgaaaaccacagcagatcctgcatcacagggatccgcaaagcctgcagcgcaa
gcatcttcactgcagctagctgtaaagacgttgccgaggaagctgtctccggtagcgcaa
gcccgcaacccagtcatgttcgtcgtctgggtcggcgcgttcctcaccacggtgtggtct
ctgttcagcccgagcgtgtactcctggacggtaaccgtgtggctgtggttcaccatcgcc
tttgccgccttcgccgaggcatacgccgaggggcggggaaaggcgcaggccgacagcctc
cgggccgtgcgagacgatgccacggcgaacctcgtccttgccgatggctcgacggaaacg
atcgccgcatccgagctgaaaaagggtgacgaggtgatcgtcgtcgctggagaaacaatc
cccggcgacggtgacgtggtacaaggagccgcgactgttgacgagtctgctatcaccggc
gagtccgctcccgttgtccgcgaggccggtggcgaccggtgcgctgtgaccggtggcacg
gtagtgctatcggatcagatccgggtgaaaattacggcagaacctggctcgacgttcgtc
gacaagatgattggcctggtggaaggtgcacaacggcggaaaacccccaacgagatcgcc
ctcagtatcttgctgtccacgctgacgatcctgttcctcgtcgccgtcaccgcgctcgcc
ccgatgggtggctttaccggcgcgaagctggagccattgtcgctcgtggcgctgctcgtg
tgtctcattcccacgacgatcgctgcccttttatccgccgttggcattgccggcatgaac
cgcttggtggagcacaacgtacttgccacctccggtcgtgcggtggaagctgcgggcgac
gtggcaacccttctcatggataagacaggaacgattacatttggcaaccgccaggccacg
ggtcttaccgtggcagacggtgtggacgaacactacgccgccgaggcggctcgagttgcc
tccattgcggacgaaacccctgagggacgttccatcgtggagtggctgaccgcgacgtac
aacatcaccgacgacatcacagacgaggtgaaaaccgccaacgtcgttccgttcacagct
accactcgcatgtctggtatcgacgtgggcggccgcttcctccgcaaaggtgcgggtgac
gcggttaaagcgtgggtaactgaggctggaggaacgtggcccgaacacatctcgatggcg
gttcacgagatcgcgcagtcaggtggcacgccactgccagtggcggaggaaacctcagac
ggctcccggcgcgttatcggcgtgttgcagctgacggacgtggtgaagccgggcatggcc
gagcgctttgccgagctccgggaaatgggtatccgaacggtcatggtcaccggcgataac
ccgctgaccgccgcggctatcgctgaggaagcaggcgtggacgatttcatcgctgaggct
accccggaagacaagctcgcccgcatccgcgaagagcaggcctccggccggatggtggca
atgaccggcgacggtacaaacgatgccccggcgctggcgcaggccgatgtcggcgtggcg
atgaacacagggacgtcggctgccaaggaggccgccaacatggtcgatctcgattcggat
ccgacgaagcttatcgacatcgtccgcatcggcaagcagctgctgatcacccgtggtgca
ctcaccacattctccctggcaaacgatttggccaagtatttcgcgatcctcccggcgctg
ttcgcggaaaaactaccgcacctgagtgccctcaacatcatgcatttgcactccccgcaa
tccgcaattgtgtcggcggtgatcttcaacgcacttatcattgtcgcgctcatcccgctc
gcgctgaagggtgtgcgctataagccggccagtgcagcgaaattgcttcgtcgcaacctc
ggcatctggggaataggtggtgtcattactccgttcatcgggatttggctcatcgatctc
gtcgtcagcttgcttccggggatgtag

DBGET integrated database retrieval system