Corynebacterium pyruviciproducens: CYJ47_08660 Help Entry CYJ47_08660       CDS       T09618                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism cpyr  Corynebacterium pyruviciproducens Brite KEGG Orthology (KO) [BR:cpyr00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CYJ47_08660 Enzymes [BR:cpyr01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CYJ47_08660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_2 GST_N_2 AhpC-TSA GST_N_5 Motif Other DBs NCBI-ProteinID:  WOT01347 UniProt:  A0AAF0YNX8 LinkDB All DBs Position 1901287..1901550 Genome browser AA seq 87 aa AA seqDB search MSTQHATIYMTDWCPYCAKLLKALDRTETPYTAVNVEEDESAAQFVESVNDGNRVVPTVH YSDGSTQTNPSASAVRQKLRELKGKEA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagtacacagcatgcgacgatttatatgactgactggtgcccctactgcgccaagttg ctcaaagctcttgacaggaccgagacaccgtacacggcagtgaatgtggaggaggacgaa agcgccgcccaattcgttgaatccgtcaacgacggcaaccgggttgtgcccacggtccac tactccgacggctccactcagacgaacccgtcggcaagcgccgtgcgacaaaagctccgc gagctcaagggcaaggaggcctag

DBGET integrated database retrieval system