Curtobacterium flaccumfaciens: GBG65_20710 Help Entry GBG65_20710       CDS       T06246                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cqf  Curtobacterium flaccumfaciens Pathway cqf01100   Metabolic pathways cqf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cqf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GBG65_20710    00074 Mycolic acid biosynthesis     GBG65_20710   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GBG65_20710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7127 Motif Other DBs NCBI-ProteinID:  QHN63505 LinkDB All DBs Position 3497748..3497996 Genome browser AA seq 82 aa AA seqDB search MALSNEEVLAGLAELINDETGIATDTVAADKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGNAVDYIVKAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccctgtccaacgaagaagtcctcgccggcctggccgagctgatcaacgacgagacc ggtatcgccaccgacaccgtcgccgccgacaagtccttcacggacgacctcgacatcgac tccatctcgatgatgaccatcgtggtcaacgccgaggagaagttcgacgtgaagatcccg gacgaagaggtcaagaacctcaagaccgtgggcaacgcggtcgactacatcgtcaaggcc caggcctga

DBGET integrated database retrieval system