Chenopodium quinoa (quinoa): 110681697 Help Entry 110681697         CDS       T05764                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism cqi  Chenopodium quinoa (quinoa) Pathway cqi03083   Polycomb repressive complex cqi04120   Ubiquitin mediated proteolysis cqi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cqi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110681697    04120 Ubiquitin mediated proteolysis     110681697   09126 Chromosome    03083 Polycomb repressive complex     110681697  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cqi04131]     110681697    04121 Ubiquitin system [BR:cqi04121]     110681697    03036 Chromosome and associated proteins [BR:cqi03036]     110681697 Membrane trafficking [BR:cqi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110681697 Ubiquitin system [BR:cqi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110681697    Cul7 complex      110681697 Chromosome and associated proteins [BR:cqi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110681697   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110681697 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ INTS5_N SNaCT7 DarP HNOB Motif Other DBs NCBI-GeneID:  110681697 NCBI-ProteinID:  XP_021713526 UniProt:  A0A803KXF6 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MASSKKIILKSADKELFEIAENAAMLSETVKNIVEAIGESNDPIPLKNVSSKILLKIIDY CNKHVEEENNDVLKQWDADFLNVDQDILFDLILAANYMEIKSLLDLTSHCVADMIKEKTP EDVRKLFNIKNDYTPEEEEKVRKENQWAFD NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggcttcctccaaaaagataatcctcaagagtgctgataaagagcttttcgagatcgcc gaaaacgcagcaatgctgtctgaaaccgtcaagaacattgtcgaagcaatcggcgaaagc aacgatccaattccactgaaaaatgtgagctcgaaaattctgttgaagatcatcgactac tgcaacaaacatgttgaggaagagaataatgatgtactcaagcaatgggatgcagatttc ctcaatgttgaccaggatattctctttgatctcattcttgctgctaattacatggaaatc aagagtttgctggatttaactagtcactgtgttgctgatatgatcaaggaaaagacacct gaggatgtaaggaagctattcaacatcaagaacgattacacacctgaagaagaggaaaaa gttcgcaaggagaaccagtgggctttcgattga

DBGET integrated database retrieval system