Chenopodium quinoa (quinoa): 110686691 Help Entry 110686691         CDS       T05764                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cqi  Chenopodium quinoa (quinoa) Pathway cqi04145   Phagosome cqi04148   Efferocytosis cqi04620   Toll-like receptor signaling pathway cqi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cqi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110686691    04148 Efferocytosis     110686691  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110686691  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110686691  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cqi04131]     110686691   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cqi04147]     110686691    04031 GTP-binding proteins [BR:cqi04031]     110686691 Membrane trafficking [BR:cqi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110686691  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110686691   Macropinocytosis    Ras GTPases     110686691  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110686691 Exosome [BR:cqi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110686691   Exosomal proteins of other body fluids (saliva and urine)    110686691   Exosomal proteins of colorectal cancer cells    110686691   Exosomal proteins of bladder cancer cells    110686691 GTP-binding proteins [BR:cqi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110686691 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  110686691 NCBI-ProteinID:  XP_021718988 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MAASASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVESTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVQKKWVPELQHYAPGVPLVLVGT KLDLRGDKHFLADHPGVLPVSTTEGEELRKQIGALYYIECSSKTQQNVKAVFDSAIKVVI KPPQKQKEKKKKPRRGFAMNICGRRSFMCFK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggctgcaagtgcttcaagattcataaaatgtgtgacagttggagatggagctgttgga aaaacttgtatgttaatttgttacactagtaacaaatttcctactgattacatcccaaca gtatttgacaatttcagtgctaatgtggttgtggaaagtaccactgtgaacttaggcctc tgggatactgctggacaagaggattacaacagattaagacctttgagctacagaggggct gatgtctttgtcttggctttctcattggtcagccgtgcgagctacgagaatgtgcaaaag aagtgggtcccggaacttcagcattatgctcctggagtaccgttggtgttggttggcacc aaattggatcttcgtggggacaagcatttcttggctgatcatcctggagtacttccagtt agcacaacagagggtgaggaactccgtaagcagattggtgctttatactacatcgagtgc agctccaagactcaacagaatgtgaaagcggtttttgattctgcaatcaaagtagtcatc aagccgcctcagaaacaaaaggagaagaaaaagaagccaaggcgagggtttgcaatgaat atctgtggtcgaaggagcttcatgtgtttcaaatga

DBGET integrated database retrieval system