Chenopodium quinoa (quinoa): 110721125 Help Entry 110721125         CDS       T05764                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cqi  Chenopodium quinoa (quinoa) Pathway cqi04145   Phagosome cqi04148   Efferocytosis cqi04620   Toll-like receptor signaling pathway cqi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cqi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110721125    04148 Efferocytosis     110721125  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110721125  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110721125  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cqi04131]     110721125   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cqi04147]     110721125    04031 GTP-binding proteins [BR:cqi04031]     110721125 Membrane trafficking [BR:cqi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110721125  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110721125   Macropinocytosis    Ras GTPases     110721125  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110721125 Exosome [BR:cqi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110721125   Exosomal proteins of other body fluids (saliva and urine)    110721125   Exosomal proteins of colorectal cancer cells    110721125   Exosomal proteins of bladder cancer cells    110721125 GTP-binding proteins [BR:cqi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110721125 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  110721125 NCBI-ProteinID:  XP_021755947 UniProt:  A0A803N6W5 LinkDB All DBs Position Unknown AA seq 196 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPISTQQGEELKRVIGAPYYIECSSKTQQNVKAVFDAAIKVVLQP PKTKKKKKKAKGCYIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagcgcatctaggttcatcaaatgtgttacagttggtgatggtgctgtgggtaaaaca tgtatgcttatttcttacaccagcaacacttttcctacggactatgtacctacagttttt gataacttcagtgctaatgttgttgttgatgggaacacagtcaacctaggtttatgggat actgcagggcaagaagactacaatagattgagacctttgagctatcgtggagctgatgtt tttattttagcgttctcgttgattagcaaagctagttatgaaaatgttgccaaaaaatgg attcccgagctcaggcattatgcacctggtgttccaataattctcgttggaacaaaacta gatcttcgagatgataagcagttttttgtagatcatcctggtgccgttcccatttcaact caacaaggagaggagctgaaaagagtcattggtgccccttactacatagagtgtagctca aaaactcaacagaatgtgaaggcagtttttgatgcggcgattaaggttgttctccagcca ccgaagaccaagaaaaagaaaaagaaggcaaaaggatgttatattttgtga

DBGET integrated database retrieval system