Chenopodium quinoa (quinoa): 32958959 Help Entry 32958959          CDS       T05764                                  Symbol psbF, CDC77_pgp048 Name (RefSeq) PsbF   KO K02708   photosystem II cytochrome b559 subunit beta Organism cqi  Chenopodium quinoa (quinoa) Pathway cqi00195   Photosynthesis cqi01100   Metabolic pathways Module cqi_M00161   Photosystem II cqi_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:cqi00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     32958959 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cqi00194]     32958959 (psbF) Photosynthesis proteins [BR:cqi00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     32958959 (psbF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-GeneID:  32958959 NCBI-ProteinID:  YP_009380146 LinkDB All DBs Position CP AA seq 39 aa AA seqDB search MTIDRTYPIFTVRWLAIHGLAVPTVSFLGSISAMQFIQR NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgaccatagatcgaacctatccaatttttacagtgcgatggctggctattcacggactg gctgtacctaccgtttcttttttggggtcaatatccgcaatgcagttcatccaacgataa

DBGET integrated database retrieval system