Crassaminicella indica: KVH43_11075 Help Entry KVH43_11075       CDS       T08466                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cras  Crassaminicella indica Pathway cras01100   Metabolic pathways cras01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cras00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KVH43_11075 (acpP)    00074 Mycolic acid biosynthesis     KVH43_11075 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KVH43_11075 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 DUF6137 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QXM05890 UniProt:  A0ABX8RDT7 LinkDB All DBs Position 2330983..2331213 Genome browser AA seq 76 aa AA seqDB search MIFEKVVEIIADQLGLEETDHIQLETSLMDDLEADSLDAVEIMMALEDEFDIEIPDEDAE KFKSIGDIAKYIEENK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgatatttgaaaaggttgttgagattattgctgatcaactaggtttggaggagacagat catattcagctagaaacttctttgatggatgatttggaagcagattctttagatgcagtt gaaattatgatggctctagaggacgaatttgatatagaaattcctgatgaggatgctgaa aaattcaagagcataggagatattgctaaatacattgaagagaataaataa

DBGET integrated database retrieval system