Capsella rubella (pink shepherd's-purse): 17890600
Help
Entry
17890600 CDS
T02984
Name
(RefSeq) SKP1-like protein 11
KO
K03094
S-phase kinase-associated protein 1
Organism
crb
Capsella rubella (pink shepherd's-purse)
Pathway
crb03083
Polycomb repressive complex
crb04120
Ubiquitin mediated proteolysis
crb04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
crb00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
17890600
04120 Ubiquitin mediated proteolysis
17890600
09126 Chromosome
03083 Polycomb repressive complex
17890600
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
crb04131
]
17890600
04121 Ubiquitin system [BR:
crb04121
]
17890600
03036 Chromosome and associated proteins [BR:
crb03036
]
17890600
Membrane trafficking [BR:
crb04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
17890600
Ubiquitin system [BR:
crb04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
17890600
Cul7 complex
17890600
Chromosome and associated proteins [BR:
crb03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
17890600
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
17890600
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Skp1_POZ
Skp1
YbaJ
RNA_pol_L
Motif
Other DBs
NCBI-GeneID:
17890600
NCBI-ProteinID:
XP_006299005
UniProt:
R0I667
LinkDB
All DBs
Position
Unknown
AA seq
161 aa
AA seq
DB search
MSTKMIVLKSSDNVEFQIEEDVARQCLTIAHWIDDENTNNGVPLTNVKGKILALVTEYCI
KHHVDREKPEDLKTWDDKWFMNLQTDPSTLLALILAANYLDNKTLLDRACQAMADMITEK
TVEQIFTDFNIEKGYTDEEEREVLEKINGLLIEKRIIKKKL
NT seq
486 nt
NT seq
+upstream
nt +downstream
nt
atgtcgacgaagatgatcgtgttgaagagctccgataatgtagagtttcagatcgaagaa
gatgtcgcaagacaatgcctgaccatagctcattggattgacgacgagaacaccaacaat
ggtgtcccgcttacaaacgtgaaaggcaagattcttgcgttggtgacggagtactgcatc
aagcaccacgtcgatcgtgagaaacccgaagatctcaagacgtgggacgacaagtggttc
atgaatttgcaaaccgatccatccaccctcttggcactcattcttgctgcgaattaccta
gacaacaaaacccttcttgaccgagcctgccaagctatggcggatatgatcacagaaaaa
actgtggaacagattttcacagacttcaacattgagaagggatacacagatgaggaagaa
agagaggttcttgagaaaataaatgggctcttgattgagaagcggattatcaagaaaaaa
ctataa
DBGET
integrated database retrieval system