KEGG   Capsella rubella (pink shepherd's-purse): 17891932
Entry
17891932          CDS       T02984                                 
Name
(RefSeq) dihydroxy-acid dehydratase, chloroplastic
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00770  Pantothenate and CoA biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17891932
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17891932
Enzymes [BR:crb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     17891932
SSDB
Motif
Pfam: ILVD_EDD FeoA
Other DBs
NCBI-GeneID: 17891932
NCBI-ProteinID: XP_006297247
UniProt: R0HXD7
LinkDB
Position
Unknown
AA seq 609 aa
MQATIFSPRATLFPCKPLVPSHNVNSRNRPSTFSCSVQSVTADPSPPSTDSNKLNKYSSR
ITEPKSQGGSQAILHGVGLSDDDLLKPQVGISSVWYEGNTCNMHLLKLSEAVKEGVENAG
MVGFRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISIPGCDKNMPG
TIMAMGRLNRPGIMVYGGTIKPGHFQEKTYDIVSAFQSYGEFVSGSISDEQRKTVLHHSC
PGAGACGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGRYLLELLKMDLKP
RDIITPKSLRNAMVTVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVSDAVPFLADLKP
SGKYVMEDIHKIGGTPAVLRYLLEHGFMDGDCMTVTGQTLAQNLENVPSLTEGQEIIRPV
SNPIKETGHIQILRGDLAPDGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMSFKG
TVVVIRGEGPKGGPGMPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPEAQ
EGGPIGLIKNGDIITIDIGKKRIDTQVSPEEMNERRKKWTAPAYKVNRGVLYKYIKNVQS
ASDGCVTDE
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgcaagccaccatcttttccccacgcgccactctcttcccctgtaaacctctcgtccct
tcccacaatgtcaactctcgcaaccgcccttcaaccttctcctgctccgttcaatccgta
acagctgatccttccccaccttccactgactccaataagctcaacaagtacagctcgagg
atcactgaacccaaatcgcaaggagggtctcaagcgattcttcacggcgtgggtttatca
gacgacgatttgctgaaaccccaagttggtatctcgtcggtgtggtacgaagggaacacc
tgcaatatgcatttgctgaagttgtctgaggctgtgaaagaaggagttgaaaatgcaggg
atggttgggtttaggtttaatacgattggtgtgagtgatgctatctcaatgggaacgaga
gggatgtgttttagtttgcaatctagggatttgattgctgacagtattgagactgtgatg
agtgctcaatggtatgatggcaacatatctattcctggttgtgataaaaatatgcctgga
actattatggctatggggaggcttaacagaccaggcattatggtttatggtggaactatt
aagcctggccactttcaagaaaagacatatgacatagtatctgcgttccagagttatgga
gaatttgttagtggctccataagtgatgaacagaggaagactgtcctccatcattcatgt
cctggagccggagcctgtggtggcatgtacaccgctaacacaatggcttccgcaatcgaa
gccatgggaatgtcccttccttacagctcttcgatacccgctgaagacccattgaaattg
gacgagtgccgtttagccggtagatatcttttagaattgctaaagatggacttaaaacca
cgggacattatcactccaaaatcccttcgtaacgcaatggttactgtcatggcccttggg
ggttcgacaaatgctgtcttgcatctaattgctattgcaaggtctgttggtttggagttg
acccttgacgattttcagaaggtcagtgatgccgttccgttcctagcagatcttaaaccc
agtgggaaatatgttatggaggatatacataagattggtggtacgccagctgttcttcgc
tatctattagagcatggatttatggatggggattgtatgacagtcacagggcagactttg
gctcaaaatttagaaaacgttccctccttaacagaagggcaggagataattagacctgtg
tcaaatccaatcaaggagacaggacacatacaaatcttgagaggagaccttgcaccagat
ggttctgtagcaaaaattaccggcaaagagggcttatatttctctggtcctgcgcttgta
tttgaaggagaggaatctatgctggctgctatatcagcagacccaatgagctttaagggg
acagtggttgttatcagaggagaggggcctaaaggaggtccaggtatgcctgaaatgttg
acaccgacaagtgcaataatgggtgccggtcttggaaaggaatgtgcattactgactgat
ggtaggttctctggtgggtcacacggttttgttgttggccacatttgccctgaagctcag
gagggaggtccaatcggtttgataaagaacggagacataatcaccattgacataggaaag
aagagaatagacacacaagtctcacccgaagaaatgaatgagcgtagaaagaaatggact
gctcctgcatacaaggttaaccgcggagtcctatacaagtacatcaagaatgtgcaatcg
gcttcagatggatgtgtgactgatgagtaa

DBGET integrated database retrieval system