Chlamydomonas reinhardtii: CHLRE_01g061442v5 Help Entry CHLRE_01g061442v5 CDS       T01039                                  Name (RefSeq) uncharacterized protein   KO K03872   elongin-C Organism cre  Chlamydomonas reinhardtii Pathway cre04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CHLRE_01g061442v5  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cre04121]     CHLRE_01g061442v5    03400 DNA repair and recombination proteins [BR:cre03400]     CHLRE_01g061442v5 Ubiquitin system [BR:cre04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      CHLRE_01g061442v5    Cul5 complex      CHLRE_01g061442v5 DNA repair and recombination proteins [BR:cre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      CHLRE_01g061442v5 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ tRNA-synt_2 BTB Motif Other DBs NCBI-GeneID:  5725744 NCBI-ProteinID:  XP_001700238 UniProt:  A8JCS9 LinkDB All DBs Position 1:complement(7879079..7881180) Genome browser AA seq 100 aa AA seqDB search MPKQTVKLVSAEGYEFIVDYKAACVSNTIRNMLSSQGSFTETELGEVKFPEISTPILEKV CQYFYYKLRYQNSTTKNIPEFKVAPEIALELLMAANFLDT NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccgaagcaaacggtgaagctggtctccgcggagggctatgagttcattgtggactac aaggccgcgtgcgtgtccaacaccatccgcaacatgctcagctcccaaggtagcttcacg gagacggagctgggcgaggtgaagttcccggagatctccacgcccatcctggagaaggtc tgccagtacttttactacaaactgcgctaccagaactccaccaccaagaacatccctgag ttcaaggtggcgccggagatcgccctggagctgctcatggccgcaaacttcctggacacg tag

DBGET integrated database retrieval system