Chlamydomonas reinhardtii: CHLRE_02g095093v5 Help Entry CHLRE_02g095093v5 CDS       T01039                                  Name (RefSeq) uncharacterized protein   KO K10881   26 proteasome complex subunit DSS1 Organism cre  Chlamydomonas reinhardtii Pathway cre03050   Proteasome cre03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     CHLRE_02g095093v5   09124 Replication and repair    03440 Homologous recombination     CHLRE_02g095093v5  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cre03019]     CHLRE_02g095093v5    04131 Membrane trafficking [BR:cre04131]     CHLRE_02g095093v5    03051 Proteasome [BR:cre03051]     CHLRE_02g095093v5    03400 DNA repair and recombination proteins [BR:cre03400]     CHLRE_02g095093v5 Messenger RNA biogenesis [BR:cre03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      CHLRE_02g095093v5 Membrane trafficking [BR:cre04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     CHLRE_02g095093v5 Proteasome [BR:cre03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      CHLRE_02g095093v5 DNA repair and recombination proteins [BR:cre03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      CHLRE_02g095093v5 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  5726775 NCBI-ProteinID:  XP_001701229 UniProt:  A8JEK8 LinkDB All DBs Position 2:3340435..3342031 Genome browser AA seq 83 aa AA seqDB search MTESKKPEAAKEPVAKEEAKPQEPVADLLEADDLFEEFGTSEWQATKDDESVPMWEADWE DENVADDFTGRLKRELDGARMKD NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacggagtccaagaagcctgaggctgcgaaggaaccagtggccaaggaggaggctaag ccccaagagccggtggcagacctgcttgaggcggatgacctgttcgaggagttcggcacc tctgagtggcaagccaccaaggacgacgagtctgtgccgatgtgggaggcggactgggag gacgagaacgtggcagatgacttcacaggccgtctgaagcgggagctggacggagcccgc atgaaggactga

DBGET integrated database retrieval system