Chlamydomonas reinhardtii: CHLRE_03g181150v5 Help Entry CHLRE_03g181150v5 CDS       T01039                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism cre  Chlamydomonas reinhardtii Pathway cre04814   Motor proteins Brite KEGG Orthology (KO) [BR:cre00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     CHLRE_03g181150v5  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cre03037]     CHLRE_03g181150v5    04812 Cytoskeleton proteins [BR:cre04812]     CHLRE_03g181150v5 Cilium and associated proteins [BR:cre03037]  Motile cilia and associated proteins   Dynein arm    CHLRE_03g181150v5 Cytoskeleton proteins [BR:cre04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      CHLRE_03g181150v5 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Motif Other DBs NCBI-GeneID:  5728480 NCBI-ProteinID:  XP_001702907 UniProt:  Q39580 A8JH45 Structure PDBPDBj LinkDB All DBs Position 3:5076986..5077675 Genome browser AA seq 91 aa AA seqDB search MASGSSKAVIKNADMSEEMQADAVDCATQALEKYNIEKDIAAYIKKEFDRKHNPTWHCIV GRNFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgggtagctccaaggccgtcatcaagaatgcggacatgtctgaggagatgcag gcagacgccgtggactgcgccactcaggccctggagaagtacaacatcgagaaggacatt gcggcctacatcaagaaggagttcgaccggaagcacaacccgacgtggcactgcatcgtc ggccgcaacttcggctcctacgtaacacacgaaacgaagcacttcatttacttctacctt gggcaggtggccatcctgctgttcaagtcgggctaa

DBGET integrated database retrieval system