Chlamydomonas reinhardtii: CHLRE_07g342352v5 Help Entry CHLRE_07g342352v5 CDS       T01039                                  Name (RefSeq) uncharacterized protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism cre  Chlamydomonas reinhardtii Pathway cre03020   RNA polymerase cre03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cre00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CHLRE_07g342352v5   09124 Replication and repair    03420 Nucleotide excision repair     CHLRE_07g342352v5  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cre03021]     CHLRE_07g342352v5    03400 DNA repair and recombination proteins [BR:cre03400]     CHLRE_07g342352v5 Transcription machinery [BR:cre03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CHLRE_07g342352v5   RNA polymerase III system    RNA polymerase III      CHLRE_07g342352v5   RNA polymerase I system    RNA polymerase I      CHLRE_07g342352v5 DNA repair and recombination proteins [BR:cre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CHLRE_07g342352v5 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_ribbon_RPAB4 Zn_ribbon_LysW Zn_Ribbon_YjdM Prok-RING_1 C1_1 Zn_ribbon_3 Zn_ribbon_13 DUF1451 DZR Zn_ribbon_NUD At4g08330 A2L_zn_ribbon DUF5816 Zn_ribbon_DZR_6 HypA Motif Other DBs NCBI-GeneID:  5717990 NCBI-ProteinID:  XP_001692523 UniProt:  A8ITN4 LinkDB All DBs Position 7:complement(4192022..4193320) Genome browser AA seq 58 aa AA seqDB search MSGYGTMPATVTMGVPYICGQCGSEISLKPGDIIQCRECGYRILYKKRTNKVVQFEAR NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgagcggctacgggactatgccggcgactgtgacgatgggcgtgccctacatttgcggg caatgcggttcagagattagtctgaagcccggcgacatcatccagtgccgtgagtgcggt taccgcatcctgtacaagaagcggacgaacaaggtcgtgcagtttgaggcccggtaa

DBGET integrated database retrieval system