Chlamydomonas reinhardtii: CHLRE_12g546400v5 Help Entry CHLRE_12g546400v5 CDS       T01039                                  Name (RefSeq) uncharacterized protein   KO K10419   dynein light chain roadblock-type Organism cre  Chlamydomonas reinhardtii Pathway cre04145   Phagocytosis cre04814   Motor proteins Brite KEGG Orthology (KO) [BR:cre00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     CHLRE_12g546400v5   09142 Cell motility    04814 Motor proteins     CHLRE_12g546400v5  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cre04131]     CHLRE_12g546400v5   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cre03037]     CHLRE_12g546400v5    04812 Cytoskeleton proteins [BR:cre04812]     CHLRE_12g546400v5 Membrane trafficking [BR:cre04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     CHLRE_12g546400v5 Cilium and associated proteins [BR:cre03037]  Motile cilia and associated proteins   Dynein arm    CHLRE_12g546400v5 Cytoskeleton proteins [BR:cre04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      CHLRE_12g546400v5 SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 LAMTOR5 Motif Other DBs NCBI-GeneID:  5719586 NCBI-ProteinID:  XP_001694098 UniProt:  A8IY95 Structure PDBPDBj LinkDB All DBs Position 12:8686131..8688069 Genome browser AA seq 100 aa AA seqDB search MSDIESTLTRIQGHKGVIGVIIVNNQGVPLRSTFEHDAMTKQYADLVPGLADLARNLVRD LDPQNDLEFLRIRSHKHEIMVAAKDDFVLLVIQDPNAAST NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtcggatatcgagtcaactctgacccggatacaagggcacaagggcgtcatcggtgtc attatcgtgaacaaccagggcgtgccgcttcgaagcacgttcgagcatgatgccatgacc aagcaatacgcagacttggtgcctggcctcgcggaccttgcgcgcaacctggtgcgcgac ctggacccccagaacgacctcgagttcctgcggatccgctcacataaacatgaaatcatg gtagcagcaaaggacgacttcgtcctgctagtcatccaggaccccaacgcggcctccaca taa

DBGET integrated database retrieval system