Chlamydomonas reinhardtii: CHLRE_13g565550v5 Help Entry CHLRE_13g565550v5 CDS       T01039                                  Name (RefSeq) uncharacterized protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism cre  Chlamydomonas reinhardtii Pathway cre03020   RNA polymerase cre03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cre00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CHLRE_13g565550v5   09124 Replication and repair    03420 Nucleotide excision repair     CHLRE_13g565550v5  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cre03021]     CHLRE_13g565550v5    03400 DNA repair and recombination proteins [BR:cre03400]     CHLRE_13g565550v5 Transcription machinery [BR:cre03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      CHLRE_13g565550v5 DNA repair and recombination proteins [BR:cre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CHLRE_13g565550v5 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Motif Other DBs NCBI-GeneID:  5719044 NCBI-ProteinID:  XP_001693682 UniProt:  A8HRP7 LinkDB All DBs Position 13:complement(588641..590072) Genome browser AA seq 115 aa AA seqDB search MNQPDRYVQFVLPEGERKVKYKADTKLKDAGTFTFRSEDHTIGNLLRMQLHADKSTVFAG YRIPHPLEPVMVVKVQTNGTKSCEDAMMHALEDLANEYHIMLEEFDQAVSAASMH NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaaccaaccggaccgttacgtacagttcgtgctcccagagggagagcggaaagtcaag tacaaggcggacaccaagctgaaggatgcgggcacgttcacctttcgctcagaggaccat accattggcaacctgctgcgcatgcagctgcacgcagacaagtcgaccgtcttcgcgggc taccggataccccaccccttggagccggtgatggtggtcaaggtgcagaccaacggcacc aagagctgcgaggacgccatgatgcacgcgctggaggacctggccaatgagtaccacatc atgctagaggagtttgaccaggctgtgtcggcagccagcatgcactga

DBGET integrated database retrieval system