Chlamydomonas reinhardtii: CHLRE_17g702550v5 Help Entry CHLRE_17g702550v5 CDS       T01039                                  Name (RefSeq) uncharacterized protein   KO K25829   transcription elongation factor 1 Organism cre  Chlamydomonas reinhardtii Brite KEGG Orthology (KO) [BR:cre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cre03400]     CHLRE_17g702550v5 DNA repair and recombination proteins [BR:cre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      Other TCR factor       CHLRE_17g702550v5 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_ribbon_Elf1 Zn_ribbon_PaaD Zn_ribbon_IS1595 DUF7837 Lar_restr_allev zf_DPOE_2 IBR_1 Motif Other DBs NCBI-GeneID:  5717278 NCBI-ProteinID:  XP_001691592 UniProt:  A0A2K3CP32 LinkDB All DBs Position 17:complement(872137..873538) Genome browser AA seq 82 aa AA seqDB search MGKRKGGSKPPPKKARAKLDTLFSCPFCNSSKSVSINFDRDMGRATAKCSQCSQKYESRC TPLTDAVDVYHDWLDSCEEANK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgggcaagcgcaagggaggcagcaaacctccaccgaagaaggcccgcgcgaagctggac acgcttttctcgtgccctttctgcaacagcagcaagtccgtatctatcaacttcgaccgc gatatggggcgagccacggccaagtgctcacagtgcagccaaaagtacgagagccgatgc acgccgctgacggacgccgtggatgtttaccatgactggttagactcgtgcgaggaggcc aacaagtag

DBGET integrated database retrieval system