Magallana gigas (Pacific oyster): 105318798 Help Entry 105318798         CDS       T03920                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism crg  Magallana gigas (Pacific oyster) Pathway crg04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:crg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105318798  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:crg04121]     105318798    03400 DNA repair and recombination proteins [BR:crg03400]     105318798 Ubiquitin system [BR:crg04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      105318798    Cul5 complex      105318798 DNA repair and recombination proteins [BR:crg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      105318798 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  105318798 NCBI-ProteinID:  XP_011414385 UniProt:  A0A8W8KCG1 LinkDB All DBs Position 3:44097874..44102017 Genome browser AA seq 120 aa AA seqDB search MDVFLMIRRKKTTIFTDAKESTPVSDVKKIVEGILKIRPEDQKLFKDDQPLDDNKTLGDY GFTFATARAQAPATIGLACKQDDGEFEQLEITPLSSPPELPDVMKQQDSTSAHAQEQTAS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcttgatgatcagaagaaaaaagactaccatctttacagatgcaaaagag tcaaccccagttagcgatgtgaaaaaaattgtagaaggtattctaaagatcagacctgaa gatcaaaagctgttcaaagatgatcagccactagatgacaacaaaacgctaggagattat gggtttacttttgcaacagcaagagcacaagctccagctactatcggactggcttgtaaa caagatgatggcgagtttgaacagttagagatcacccccctatccagtcccccggagcta ccagatgtgatgaaacaacaagactccacatcggcacatgcacaagaacaaacagcatct taa

DBGET integrated database retrieval system