Magallana gigas (Pacific oyster): 105328475 Help Entry 105328475         CDS       T03920                                  Name (RefSeq) cdc42 homolog   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism crg  Magallana gigas (Pacific oyster) Pathway crg04145   Phagosome crg04148   Efferocytosis crg04310   Wnt signaling pathway crg04620   Toll-like receptor signaling pathway crg05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:crg00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105328475  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105328475    04148 Efferocytosis     105328475  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105328475  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105328475  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crg04131]     105328475   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:crg04147]     105328475    04031 GTP-binding proteins [BR:crg04031]     105328475 Membrane trafficking [BR:crg04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105328475  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105328475   Macropinocytosis    Ras GTPases     105328475  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105328475 Exosome [BR:crg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105328475   Exosomal proteins of other body fluids (saliva and urine)    105328475   Exosomal proteins of colorectal cancer cells    105328475   Exosomal proteins of bladder cancer cells    105328475 GTP-binding proteins [BR:crg04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105328475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Matrix_Pneumo_N Motif Other DBs NCBI-GeneID:  105328475 NCBI-ProteinID:  XP_011427672 UniProt:  K1RB78 LinkDB All DBs Position 6:5481975..5483108 Genome browser AA seq 185 aa AA seqDB search MVVSVNKSLQCSVVGDGFVGKSCLVERFLGGEFNSEYVATLQDDYIAKCNVNGDSLEMNI TDFAGEHDDLVSIEVPDVFVVCFSLVDKDSLESVLNFWVPRIRSEEKQTPIVLVGTQLDK RRTQRKGHISTEEGLSLAQSISASAYVECSAKDNTGVDVALYSILLASNKYNRRKASLFK RVLGR NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atggttgtttctgtgaacaagtctctgcagtgttcggttgttggggacggatttgtgggg aagtcgtgtcttgttgagcgatttcttggtggagaatttaacagcgaatatgtggccact cttcaagatgactacattgcaaagtgcaacgttaatggtgacagcttagagatgaatatt acggacttcgctggagagcatgacgaccttgtctccatcgaagtgcccgatgtctttgtt gtctgctttagccttgtggacaaggactcgctcgaaagcgtgctcaacttctgggttcca agaataagatccgaagagaagcaaacgccaatcgtcttagtcggaacccagctagacaag agaagaacacaaagaaagggccatatttctaccgaagaagggctcagtctcgctcagtct atcagcgcttcagcctacgtggaatgttcggcgaaagacaacacaggggtggatgttgcg ctttacagcatccttctggctagcaacaagtacaacagaaggaaagccagtctctttaaa cgcgttcttggcagatga

DBGET integrated database retrieval system