Magallana gigas (Pacific oyster): 105333108 Help Entry 105333108         CDS       T03920                                  Name (RefSeq) cdc42 homolog   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism crg  Magallana gigas (Pacific oyster) Pathway crg04145   Phagosome crg04148   Efferocytosis crg04310   Wnt signaling pathway crg04517   IgSF CAM signaling crg04518   Integrin signaling crg04620   Toll-like receptor signaling pathway crg05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:crg00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105333108   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105333108    04518 Integrin signaling     105333108  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105333108    04148 Efferocytosis     105333108  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105333108  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105333108  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crg04131]     105333108   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:crg04147]     105333108    04031 GTP-binding proteins [BR:crg04031]     105333108 Membrane trafficking [BR:crg04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105333108  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105333108   Macropinocytosis    Ras GTPases     105333108  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105333108 Exosome [BR:crg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105333108   Exosomal proteins of other body fluids (saliva and urine)    105333108   Exosomal proteins of colorectal cancer cells    105333108   Exosomal proteins of bladder cancer cells    105333108 GTP-binding proteins [BR:crg04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105333108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  105333108 NCBI-ProteinID:  XP_011434235 UniProt:  K1RDM5 LinkDB All DBs Position 6:47787195..47790044 Genome browser AA seq 197 aa AA seqDB search MVVLRSDFIKCVVLGDDSVGKTSLLVNYATNRFPTTHVPSVFDNYAGTLEMSGKKYHLQL LDTLEEDKEQDNSTHILPGADIVVVCYSVVQPTSFSNVESKWIPTVRRCLGEVPIILVGT QTDLRLDCSVQTSLHQNGLKCISSIEGFHMARKIGASRFFESSPELEKRMKRVLNKAIGT VLHPRDGLSEALSCAIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atggtcgtacttcgttcggacttcattaagtgtgttgtgctaggggatgactccgtgggg aaaacaagtctactagtgaactacgctacaaatagatttcctactacgcacgtgcccagt gttttcgataactatgcaggaacattagaaatgtcagggaaaaagtatcacttgcagctt cttgacacattggaagaagacaaagaacaagataacagtactcacattctgccgggagct gacatcgttgtcgtctgctattctgtggtccagcctacttcttttagcaacgtagagtca aagtggataccgactgtccggcggtgtctgggggaggtccccatcatcctggtgggaacc cagacggacctccgcctagactgctctgtgcaaactagtttacaccagaatggactcaaa tgcatcagttctatcgaaggtttccacatggctagaaaaataggagcctctcgatttttt gagagttcgccggaactagagaagagaatgaagagggtgttgaataaagcgatagggacg gttctccaccccagagatggcctctccgaggccctgtcatgtgccattctgtag

DBGET integrated database retrieval system