Magallana gigas (Pacific oyster): 105342781 Help Entry 105342781         CDS       T03920                                  Name (RefSeq) ras-like GTP-binding protein RHO   KO K04513   Ras homolog gene family, member A Organism crg  Magallana gigas (Pacific oyster) Pathway crg04081   Hormone signaling crg04144   Endocytosis crg04150   mTOR signaling pathway crg04310   Wnt signaling pathway crg04350   TGF-beta signaling pathway crg05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:crg00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105342781    04350 TGF-beta signaling pathway     105342781    04150 mTOR signaling pathway     105342781   09133 Signaling molecules and interaction    04081 Hormone signaling     105342781  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105342781  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105342781  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crg04131]     105342781   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:crg04147]     105342781    04031 GTP-binding proteins [BR:crg04031]     105342781 Membrane trafficking [BR:crg04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     105342781 Exosome [BR:crg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105342781   Exosomal proteins of other body fluids (saliva and urine)    105342781   Exosomal proteins of colorectal cancer cells    105342781   Exosomal proteins of bladder cancer cells    105342781 GTP-binding proteins [BR:crg04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     105342781 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Dynamin_N ABC_tran PduV-EutP Motif Other DBs NCBI-GeneID:  105342781 NCBI-ProteinID:  XP_011448136 LinkDB All DBs Position 4:50871620..50875278 Genome browser AA seq 182 aa AA seqDB search MATIRKKLVVVGDSACGKSCLLTVFSGHQFSELFENYTTNVQIEGKKVELALWDTSGKRE YDRLRLLSYPNADVILLCYSIDNTESLANISEKWVPEVKLYCPNTPMILIGNKKDTRNVE RSQKEQEPVKLEDGKAMAEKINALAYTECSAKTKEGVRGLFETASRAALRGKNTTKNECL LQ NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atggcaaccattagaaagaagttagtggtagtaggagatagtgcttgcggtaaatcctgt ctcctcactgttttcagcggacaccagttctcggagctatttgaaaactacacaacaaac gtccaaatcgaggggaaaaaggttgagttggcattatgggatacatcagggaaaagagaa tacgacagacttcgccttctctcgtaccccaacgcagacgtcattcttctctgttactcc atagacaacactgagagtttagcaaatatctcagaaaaatgggtaccggaagttaaactc tactgtccaaatacccccatgattttaattggaaacaaaaaagacaccagaaatgtcgaa cgctcacaaaaagaacaagaaccagtcaagttagaagatggaaaggcgatggccgaaaaa atcaatgctctcgcctacactgagtgttcggctaaaacgaaggagggagtaagaggactg tttgaaacagccagtcgggcggctctacgaggcaagaatacgacgaagaatgagtgtcta ttgcagtga

DBGET integrated database retrieval system