Magallana gigas (Pacific oyster): 105347620 Help Entry 105347620         CDS       T03920                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism crg  Magallana gigas (Pacific oyster) Pathway crg04137   Mitophagy - animal crg04140   Autophagy - animal crg04144   Endocytosis crg04145   Phagosome crg04148   Efferocytosis Brite KEGG Orthology (KO) [BR:crg00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105347620    04145 Phagosome     105347620    04140 Autophagy - animal     105347620    04137 Mitophagy - animal     105347620    04148 Efferocytosis     105347620  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crg04131]     105347620   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:crg04147]     105347620    04031 GTP-binding proteins [BR:crg04031]     105347620 Membrane trafficking [BR:crg04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     105347620 Exosome [BR:crg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105347620   Exosomal proteins of other body fluids (saliva and urine)    105347620   Exosomal proteins of colorectal cancer cells    105347620   Exosomal proteins of bladder cancer cells    105347620 GTP-binding proteins [BR:crg04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     105347620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 PduV-EutP cobW Septin nSTAND3 AAA_7 AAA_22 NTPase_1 AAA_16 AAA_24 AAA_5 G-alpha ATPase_2 NACHT NB-ARC AAA_14 ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  105347620 NCBI-ProteinID:  XP_011455069 UniProt:  K1PZ08 LinkDB All DBs Position 4:complement(7906363..7911832) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTMPNTFKSLDSWRDEFLIQASPRDPENFPF VVIGNKIDLENRAVTAKRAQSWCTSKGEIPYFETSAKEAINVEQAFQTVAKNALAQETEV ELYNEFPDQIKLTNDTKKQESGCGC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcatcaagaaagaaggtgttattaaaagttattatacttggggacagtggagtcggt aagacatccctcatgaaccagtatgtgaacaagaagttcagtaaccaatacaaagccacc attggagcagattttctgaccaaagaagtgatggtagacgacagactagtcacaatgcag atttgggacacagcgggacaggagagatttcagtcgctgggtgtggcgttctacagggga gctgactgttgtgttcttgtgtttgatgtcacaatgccaaacacattcaaatctttggac agttggagggacgaattcctcatccaggccagtcccagggaccctgaaaatttcccgttt gttgttataggaaataaaatcgacttggaaaatagggcggtgactgccaagagagcacag agttggtgcactagtaaaggagagattccttattttgagaccagtgctaaagaggccatc aatgtagaacaggctttccaaactgtcgctaagaatgccctggctcaagaaacagaagtg gaattgtataatgagtttcctgaccaaattaaacttacaaacgatactaaaaagcaagag agtggatgtggctgctaa

DBGET integrated database retrieval system