Corynebacterium riegelii: AK829_02810 Help Entry AK829_02810       CDS       T09801                                  Name (GenBank) hypothetical protein   KO K03210   preprotein translocase subunit YajC Organism crie  Corynebacterium riegelii Pathway crie02024   Quorum sensing crie03060   Protein export crie03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:crie00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AK829_02810  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AK829_02810  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AK829_02810  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:crie02044]     AK829_02810 Secretion system [BR:crie02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    AK829_02810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YajC DUF6350 PDZ_6 Motif Other DBs NCBI-ProteinID:  AKV58269 UniProt:  A0A0K1RA35 LinkDB All DBs Position 580520..580801 Genome browser AA seq 93 aa AA seqDB search MELLPLLLILGLFLLPSLLMMRSQRRRAREVEAMRASLVPGDRIVSVAGVHGTVVAVGEQ GQEQGAIDVEIAPGVVVTMELAGVMKKDAEVMP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaactcttgccacttcttcttattcttggcctttttcttctgccttcgctgctcatg atgcgctcccagcgcaggagggcacgtgaagtagaagccatgcgtgcttcgctggttccg ggggatcgcattgtaagcgtggcaggtgttcacggcactgtggtggccgtgggcgagcag ggccaggagcagggcgcaattgatgtggagatcgcaccgggtgtagtggtcaccatggag ctggccggagtgatgaagaaagacgcagaggtcatgccgtag

DBGET integrated database retrieval system