Comamonas resistens: QMY55_02500
Help
Entry
QMY55_02500 CDS
T09688
Name
(GenBank) ATP-binding cassette domain-containing protein
KO
K15738
ABC transport system ATP-binding/permease protein
Organism
crj
Comamonas resistens
Brite
KEGG Orthology (KO) [BR:
crj00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
crj02000
]
QMY55_02500
Transporters [BR:
crj02000
]
ABC transporters, eukaryotic type
Other subfamilies
Other ABC transporters
QMY55_02500
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_tran_CTD
AAA_21
ABC_tran_Xtn
SMC_N
AAA_29
AAA_22
ATP-synt_ab
AAA_16
MMR_HSR1
AAA_30
NACHT
RsgA_GTPase
AAA_23
AAA
AAA_15
TsaE
Zeta_toxin
nSTAND3
nSTAND1
cobW
DO-GTPase2
Motif
Other DBs
NCBI-ProteinID:
WHS66048
UniProt:
A0ABY8ST06
LinkDB
All DBs
Position
complement(541720..543612)
Genome browser
AA seq
630 aa
AA seq
DB search
MALITLLDAQLAFGHVALLDHTTFSLEAGERVGLIGRNGAGKSSLLKILGGLAKADDGQL
QVQNGVRITYVAQEPDLNPEHTIFESASDGIAAVIAIRERYLAGGEGEDLDALQTQIEAY
DAWNWEQRVEETLQRLHLDPTALVGSLSGGTRKRVALAQALVARPDVLLLDEPTNHLDLD
SIEWLEELLIAFKGSVVTITHDRSFLDRIATRIVELDRGILRTYPGNFSQYVLQKEEQLN
QEAIINAKADKLLAQEEIWIRKGVEARRTRSQSRISRLQELRANRAQRRDVLGGVNMDIA
SGKGDGYQGKIVAELTGVSKTFGEKKIVERFSGTILRGDKVGLLGPNGAGKTTLLKMILG
ELAPDSGQVRLGGNLQVAYFDQMRHQVDLDATLEDFISPGSEWIEIGSQKKHVKSYLADF
LFSPARAHSPVRSLSGGERNRLLLARLFARPANVLVLDEPTNDLDIETLDMLEELLQNYD
GTVFLVSHDRTFLDNVVTSTIAWEGPGHWREYEGGVTDWMEQSRRSKAIAEAAQAKAQPK
EEAKPAQARSETPAATTAKKKLSYKEQRELEALPELIASLEAEQKQIQDALADGSLYASD
NAKAVAMHQRDAEIDEALMEALERWTLLSE
NT seq
1893 nt
NT seq
+upstream
nt +downstream
nt
atggcactgattactttgttggacgctcaactggcgttcgggcatgtggcccttctggac
cacaccactttttccctggaagccggcgagcgtgtcggcttgattggccgtaacggcgct
ggtaagtcttcgctgctcaagatcctgggcggcttggccaaggccgatgacggccagctc
caggttcaaaacggggtccgcattacttatgtggcgcaagagccggatctgaaccctgag
cacacgatcttcgagtctgcttcggacggcattgcagcggtgattgcaatccgcgagcgc
tatctggcgggcggtgaaggcgaggatctggatgcgctgcagacgcagatcgaggcttat
gacgcctggaactgggagcagcgcgtggaagagacgctgcagcgcctgcatctggacccc
accgctttggtgggcagcctgtctggcggcacccgcaagcgcgtggcattggcacaggct
ctggtggcccgccccgacgtgctgctgctggacgagccgaccaaccacctggacctggat
tcgatcgagtggctggaagagctgctgattgcgttcaagggcagcgtcgtcaccattacc
cacgaccgcagctttctggatcgcattgcgacacgcatcgtggaactggatagaggcatt
ctgcgcacctaccctggcaatttttcccagtatgtgctgcagaaggaagagcagctcaat
caggaagcgatcatcaacgccaaggccgacaagctgctggcccaggaagagatctggatc
cgcaagggtgtggaagcccgccgcacccgcagccaaagccgtatttcccgcctgcaggag
ctgcgggccaatcgcgcacagcgccgcgatgtgctgggtggcgtgaatatggatatcgcc
tcgggcaagggcgacggctatcagggcaagatcgtggccgagctcaccggtgtcagcaag
acctttggtgaaaagaagatcgttgaaagattcagcggcaccatcctgcgtggcgacaag
gtgggcctgctggggccgaacggcgccggcaagaccaccttgctcaagatgattctgggc
gagctggctcccgacagcggtcaggtacgcctggggggcaatcttcaggtggcttacttc
gaccagatgcgccaccaggtggatctggatgcgaccctggaggacttcatcagcccgggc
agcgagtggatcgagatcggcagccagaaaaagcacgtcaagagctatctggccgacttt
ctgttctctccggcccgtgcgcactccccggtccgatcgctgtctggcggcgagcgcaac
cgtttgctgctggcccgcctgtttgcccgccctgccaatgtcctggtgctggacgagccg
accaacgacctcgacatcgagacgctggacatgctggaagagctgctgcagaactatgac
ggtacggtcttcctcgtcagccacgaccgtaccttcctggacaacgtggtcaccagcact
attgcctgggaaggtccgggccactggcgtgaatacgaaggtggcgtgacggactggatg
gagcagtcacgccgcagcaaggcgattgccgaagcagcacaggccaaggctcagcccaag
gaggaagccaaaccggcgcaagcccgtagcgaaacgcccgcagcaacgactgccaagaaa
aagctcagctacaaggagcagcgtgagctggaagccctgcctgagctgattgcctcactg
gaggccgagcagaagcagattcaggatgcactggccgacggcagcctgtatgcatccgat
aacgccaaggcggttgccatgcatcagcgcgatgcggagattgacgaagcgctgatggag
gcgctggagcgctggacgttgctgtccgaataa
DBGET
integrated database retrieval system