Comamonas resistens: QMY55_05350 Help Entry QMY55_05350       CDS       T09688                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism crj  Comamonas resistens Pathway crj01100   Metabolic pathways crj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:crj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QMY55_05350 (acpP)    00074 Mycolic acid biosynthesis     QMY55_05350 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QMY55_05350 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  WHS66564 LinkDB All DBs Position 1184783..1185022 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgctgaacaactcggcgttgaagag tcccaagtgaccaacgaaaaggccttcgtggccgacctgggcgctgactccctggacaca gtggaactggtgatggccctggaagatgaattcggcatcgagatccctgacgaagacgca gagaagatcacgacggtgcaaaacgccatcgactacgccaatacccaccaaaaggcctaa

DBGET integrated database retrieval system