Comamonas resistens: QMY55_20325 Help Entry QMY55_20325       CDS       T09688                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism crj  Comamonas resistens Brite KEGG Orthology (KO) [BR:crj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:crj03036]     QMY55_20325 (ftsL) Chromosome and associated proteins [BR:crj03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     QMY55_20325 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC SPMIP1 Motif Other DBs NCBI-ProteinID:  WHS64810 UniProt:  A0ABY8SP05 LinkDB All DBs Position complement(4367975..4368259) Genome browser AA seq 94 aa AA seqDB search MLRINLLLLLAVMMSALFLVGTQYESRKLFTELDRAENESRRLATDQQRLQVEKRAQATP QRIETLAREKLQMRPASPAITQYVQEGSTAGAAQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgctgcgcataaatctgctgctgctgctggccgtgatgatgagcgccctttttctggtg ggaactcagtacgagtcgcgaaaactgtttaccgagctggatcgtgcggagaatgagtcg cgccgtctggccaccgatcagcagcgcctgcaggtggaaaaacgcgcccaggccacgcct cagcgcattgaaacgctggcacgtgaaaagctgcagatgcgtcccgcatcgcctgccatc acccagtatgtgcaggaaggaagcactgcgggagctgcgcaatga

DBGET integrated database retrieval system