KEGG   Comamonas resistens: QMY55_24495
Entry
QMY55_24495       CDS       T09688                                 
Symbol
yidC
Name
(GenBank) membrane protein insertase YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
crj  Comamonas resistens
Pathway
crj02024  Quorum sensing
crj03060  Protein export
crj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:crj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    QMY55_24495 (yidC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    QMY55_24495 (yidC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    QMY55_24495 (yidC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:crj03029]
    QMY55_24495 (yidC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:crj02044]
    QMY55_24495 (yidC)
Mitochondrial biogenesis [BR:crj03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    QMY55_24495 (yidC)
Secretion system [BR:crj02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   QMY55_24495 (yidC)
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP DUF2427
Other DBs
NCBI-ProteinID: WHS65577
UniProt: A0ABY8SR89
LinkDB
Position
complement(5248778..5250481)
AA seq 567 aa
MNDIRRTILWVIFGFSMVLLWDKWQIHNGKKPTFFPSPQTVSAPAANDIKPADTSLPQPA
AAASAGDVPGAAQPVAGASQPAAAAPRQDVSIASDVMRLTFDSEGGTLKASELLKYSDTA
DDKKLMQVFEQNAKRVYLGQTGLIGGNFPNHKTPMTVVPGERELKDGQDSVQLRFESAEQ
GGVKLVKTYTLKRGVYDIGVQYDVVNTGAAAVNPQIYMQLVRDGNKPEHESSFYSTFTGP
AVYTEAKKYHKVEFKDIESGKAEVDKSSTSGYVAMVQHYFASAWLLADGIQRDNFVRKVG
DNLYAVGMITPVGTVEPGQTKTVSARLFSGPQIEPMLEKLSPGLELVKDYGWLTILAKPL
YWLLSELHKFIGNWGWSIVALVVLLKIAFYWLNAKAYSSMAKMKAINPRIQEMRERLKDK
PQQMQQEMMRIYREEKVNPMGGCLPIVIQIPVFMALYWVLQSSVEIRNAPWIGWIHDLSV
PDPFFILPLLMTLSSLLQTALNPAPPDPMQAKMMWIMPLMFSVMFFFFPAGLVLYWLTNN
ILSIAQQWIINKRMGVPPQFNLPKFGK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgaacgatattcgccgcaccatactgtgggtgatatttggcttttccatggttttgctc
tgggacaagtggcaaatccataacggcaaaaagcccaccttcttcccatcgccgcagacg
gtcagcgcgcctgcggccaatgacatcaagccggcagacaccagcctgccccagcctgca
gcggctgcttcggccggtgatgttccgggtgcggctcagccggttgccggcgcgagccag
cctgccgctgcggcgcctcgccaggatgtgagcatcgccagcgacgtgatgcgtctgacc
ttcgacagcgaaggcggcacgctaaaagcttccgagctgctcaagtacagcgacaccgcg
gatgacaagaagctcatgcaggtgttcgagcagaacgccaagcgtgtgtacctgggtcag
accggcctgatcggcggcaacttccccaaccacaagacgcccatgaccgtggtgcccggc
gagcgtgagctcaaggacggccaggacagcgtgcaactgcgtttcgagtcggccgagcag
ggcggcgtgaagctggtcaagacctatacgctcaagcgcggtgtttacgacatcggcgtg
cagtacgacgtggtgaataccggcgctgcagccgtgaaccctcagatctacatgcagctg
gtgcgtgacggcaacaagcccgagcacgagtccagcttctactcgaccttcaccggcccg
gccgtctataccgaagccaagaagtaccacaaggtggagttcaaggacatcgagagtggc
aaggccgaggtcgacaagtcctccaccagcggctatgtggccatggtgcagcactacttt
gccagcgcttggctgctggctgatggcatccagcgcgacaacttcgtgcgcaaggtgggc
gacaacctctacgccgtgggcatgatcacgcccgtgggtacggtggagcccggccagacc
aagactgtcagcgcccgcctgttctccggcccccagatcgaacccatgctggagaagctc
tctcccgggctggagctggtcaaggactatggctggctgacaattctggccaagccgctg
tactggctgctgtccgagctgcacaagttcatcggcaactggggctggtccatcgtggct
ctggtggtgttgctgaagatcgccttctactggctcaatgccaaggcttactcctcgatg
gccaagatgaaggccatcaacccccgcattcaggaaatgcgtgagcgtctgaaggacaag
ccccagcagatgcagcaggagatgatgcgcatctaccgcgaggagaaggtcaaccccatg
ggaggctgcctgcccatcgtcatccagatccctgtcttcatggctctgtactgggtgttg
cagtccagcgtggaaattcgcaatgcgccctggattggctggattcacgacctctcggtg
cccgatcccttcttcatcctgcctttgctgatgactctgtcctcgctgttgcagacggcc
ctgaaccccgcgccacctgaccccatgcaggccaagatgatgtggatcatgccgctgatg
ttcagcgtgatgttcttcttcttccccgccggtctggtgctgtactggctgacgaacaat
atcctgtccatcgcccagcagtggatcatcaacaagcgcatgggcgtgccgccccagttc
aatctgccgaagttcggcaagtaa

DBGET integrated database retrieval system