KEGG   Citrobacter rodentium: ROD_00241
Entry
ROD_00241         CDS       T01145                                 
Symbol
lspA
Name
(GenBank) lipoprotein signal peptidase
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
cro  Citrobacter rodentium
Pathway
cro03060  Protein export
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_00241 (lspA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cro01002]
    ROD_00241 (lspA)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     ROD_00241 (lspA)
Peptidases and inhibitors [BR:cro01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   ROD_00241 (lspA)
SSDB
Motif
Pfam: Peptidase_A8 MscL ThrE
Other DBs
NCBI-ProteinID: CBG86805
UniProt: D2TGK3
LinkDB
Position
31126..31623
AA seq 165 aa
MSKSLSSTGLRWLWLVVVVLIIDLGSKFLILQNFALGDTVPLFPSLNLHYARNYGAAFSF
LADSGGWQRWFFAGIAIGICVILTVLMYRAKATQKLNNIAYALIIGGALGNLFDRLWHGF
VVDMIDFYVGEWHFATFNLADSAICIGAALIVLEGFIPSKQKTTA
NT seq 498 nt   +upstreamnt  +downstreamnt
atgagtaaatcgttgagttcaacagggctacgctggctgtggctggtagtcgtcgtgctg
attatcgatttgggcagcaagttcctgatcctccagaatttcgctctgggggatacggtg
ccgctgttcccgtcgcttaatctgcattatgcgcgtaactatggcgcggcattcagtttc
cttgccgatagcggcggctggcagcgctggttctttgccggtatcgctatcggtatctgc
gttattctgacggtgctgatgtaccgcgcaaaagcgacgcagaagctgaataacatcgcc
tatgcgttaatcatcggcggcgcgctgggcaacctgttcgaccgcctgtggcacggcttt
gtcgtcgatatgatcgatttctacgtcggggagtggcatttcgccacctttaacctcgcc
gatagcgcgatctgtatcggcgcggcgctgatcgtgctggaaggctttataccgtcaaaa
cagaaaaccacggcgtaa

DBGET integrated database retrieval system