KEGG   Citrobacter rodentium: ROD_00971
Entry
ROD_00971         CDS       T01145                                 
Symbol
murC
Name
(GenBank) UDP-N-acetylmuramate:alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
cro  Citrobacter rodentium
Pathway
cro00550  Peptidoglycan biosynthesis
cro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROD_00971 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_00971 (murC)
Enzymes [BR:cro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     ROD_00971 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Precursor biosynthesis
  Amino acid ligase
   ROD_00971 (murC)
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-ProteinID: CBG86877
UniProt: D2TGM8
LinkDB
Position
116526..118001
AA seq 491 aa
MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNPVTQQL
TNLGATIYFNHRPENVLDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRFRH
GIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLGHSRYLIAEADESDA
SFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRELL
PRVGRQITTYGFSDDADVRVEDYQQIGPQGHFSLLRQGMPELRVTLNAPGRHNALNAAAA
VAVATEEGIDDEAILRALESFQGTGRRFDFLGEFPLAPVNGKAGTAMLVDDYGHHPTEVD
ATIKAARAGWPDKHLVMLFQPHRFTRTRDLYDDFANVLTQVDALLMLDVYAAGEAPIPGA
DSRSLCRTIRGRGKIDPILVSDPAQVAEMLAPVLTGNDLILVQGAGNIGKIARSLAEIKL
KPQIQESEQHG
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaatacacaacaactggcaaaactgcgttctatcgtgcccgaaatgcgtcgcgttcgg
cacattcactttgtcggcatcggtggtgccggtatgggcggtattgccgaagttctggct
aacgaaggttatcagatcagtggttccgatttagcgccaaacccggtgacgcagcagctg
acgaacctgggggcgacgatttactttaatcatcgtccggaaaacgtgctcgacgcgagc
gtggtggtggtttccagcgccatctctgccgataacccggaaattgtggcggcccacgaa
gcgcgcattccggtgatccgccgcgcggagatgctggcggagctgatgcgttttcgtcac
ggcatcgccattgccggaacgcatggtaaaacgaccaccaccgccatggtttccagcatt
tatgcggaagcggggctggacccaaccttcgttaacggcggtctggtgaaggcggcgggc
gtccatgcgcgcctggggcatagccgctatttaatcgcggaggcggatgagagcgacgcg
tcgttcctgcatctgcagccgatggtggcgattgtcaccaatatcgaagctgaccatatg
gatacctaccatggcgacttcgaaaatttaaagcagacgtttattaatttcctgcataac
ctgccgttttatggtcgtgcggtgatgtgcgttgacgatccggtgatccgcgagctgctg
ccgcgggtgggccgccagatcaccacctacggctttagcgacgatgccgatgtgcgggtc
gaggattatcagcagattggcccgcaggggcacttcagcctgctacgccaggggatgccc
gaactgcgtgtgaccctcaatgcgccagggcgacataacgcgctgaacgccgcggctgcc
gtggcggtggcgacggaagagggcattgacgacgaggcgattctgcgcgcgctggagagc
ttccagggcaccggtcgccgtttcgatttcctcggtgaattcccgctggcgccggtaaac
ggcaaagctggtacggcgatgctggtggatgattacggtcatcacccaacggaagtggat
gcgactatcaaagcggcgcgcgccggctggccggataaacatctggtgatgctgtttcag
ccgcaccgctttacgcgtacccgcgatctgtatgacgactttgccaacgtgctgactcag
gtggatgcgctgctgatgctggatgtctatgctgccggcgaagcgccgattccgggcgcg
gacagccgttcgctgtgccgcactatccgagggcgcggcaagatcgatccgattctggtt
tccgatccggcgcaggttgccgaaatgctggcaccggtattaaccggcaatgatctcatt
ctggtgcagggcgcgggaaatatcggcaaaattgcgcgttccttagctgaaatcaaactg
aagccgcaaattcaggagagcgaacaacatggctga

DBGET integrated database retrieval system