KEGG   Citrobacter rodentium: ROD_01041
Entry
ROD_01041         CDS       T01145                                 
Symbol
secA
Name
(GenBank) preprotein translocase SecA subunit
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
cro  Citrobacter rodentium
Pathway
cro02024  Quorum sensing
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_01041 (secA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_01041 (secA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_01041 (secA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_01041 (secA)
Enzymes [BR:cro01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ROD_01041 (secA)
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_01041 (secA)
SSDB
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD DUF2764 DUF2175
Other DBs
NCBI-ProteinID: CBG86884
UniProt: D2TGN5
LinkDB
Position
124135..126840
AA seq 901 aa
MLIKMLTKVFGSRNDRTLRRMRKVVGVINAMEPEMEKLSDEELKAKTAEFRARLEQGASV
ESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRTGEGKTLTATLPAYLNA
LSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMTVGINLPGMPAPAKREAYAADITYGTNN
EYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSEMYKKVN
KIIPHLVRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVLIEELLVKEGIMDEGESLYS
PGNIMLMHHVTAALRAHVLFTRDVDYIVKDGEVIIVDEHTGRTMQGRRWSDGLHQAVEAK
EGVDIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIR
KDMPDLVYMTEAEKIQAIIEDIKERTANGQPVLVGTISIEKSEVVSNELTKAGIKHNVLN
AKFHANEAAIVAQAGYPSAVTIATNMAGRGTDIMLGGSWQAEIAALENPTPEQIAQIKAD
WQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSGRQGDPGSSRFYLSMEDALMRIFAS
DRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIY
TQRNELLDVSDVSETINSIREDVFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLDMPI
AEWLDKEPELHEETLRERILSQAIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLA
AMDYLRQGIHLRGYAQKDPKQEYKRESFAMFAAMLESLKYEVISTLSKVQVRMPEEVEAM
ELQRREEAERLAQMQQLSHQDDHAAAAADLAAQTGERKVGRNDPCPCGSGKKYKQCHGRL
S
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgctaatcaaaatgttaacaaaagtattcggtagtcgtaacgatcgtacgttgcgtcgt
atgcgtaaagtagtcggcgtgatcaacgccatggaaccggagatggaaaaactctccgat
gaagaactgaaggcgaaaaccgccgaattccgcgcgcgtctcgagcagggcgccagcgtg
gaaagcctgattccggaagccttcgcggttgtgcgcgaagccagtaagcgcgtgttcggc
atgcgtcacttcgacgttcagctgctcggcggtatggtgctaaacgatcgctgcatcgcg
gaaatgcgtaccggtgaaggtaaaaccctgaccgcaacgctgccggcctacctgaatgcg
ctgagcggaaagggcgtacacgtggttaccgtcaacgactatctggcccagcgtgacgcc
gagaacaaccgtccgctgttcgaattcctcggcatgaccgtcggtattaacctgccgggt
atgcctgcgccagccaagcgcgaagcctacgcagccgacattacctacggcaccaacaac
gaatatggctttgactacctgcgcgacaatatggcgttcagccctgaagagcgcgtccag
cgtaaactgcactatgcgctggtggatgaggtcgactccatcctgatcgatgaagcgcgt
acgccgcttattatttccggcccggcggaagacagctcggaaatgtataagaaggtgaac
aaaatcattccgcacctggttcgccaggaaaaagaagactccgacaccttccagggggaa
ggtcacttctcggtagatgagaaagcgcgccaggttaacctgaccgaacgcggtctggtg
ctgatcgaagagctgctggtgaaagaaggcattatggatgaaggcgagtcactgtactct
ccgggcaatatcatgctgatgcaccatgtcaccgcggcgctgcgcgcgcacgtgctgttc
acccgcgacgttgattacatcgtgaaagacggtgaagtcattatcgttgatgagcatacc
ggtcgtaccatgcagggccgtcgctggtctgatggtctgcaccaggcggttgaagccaaa
gaaggcgtggacatccagaacgaaaaccagacgctggcttccattaccttccagaactat
ttccgtctgtacgaaaagctggccggtatgaccggtacggcagacaccgaggcgtttgaa
ttcagctctatctacaagctggataccgtggtggtgccgactaaccgtccgatgatccgt
aaagatatgccggatctggtctacatgaccgaagcggaaaaaattcaggccatcattgaa
gatatcaaagagcgtaccgcaaatggtcagccggtgctggtcggtacgatctccattgag
aaatctgaagtcgtttctaacgagctgactaaagcaggcatcaagcataacgttctgaac
gccaagttccacgccaacgaagcggcgattgtcgcgcaggcgggttatccgtcggcggtg
actatcgccaccaacatggccggtcgcggtacggatattatgctgggcggtagctggcag
gcggaaatcgccgcgctggaaaatccgacgccggagcagatcgcgcagatcaaagcggac
tggcaggtgcgtcacgatgcggtcctggctgcgggcggcctgcacatcattggtactgag
cgtcacgaatcacgtcgtatcgataaccagctgcgcggccgttcgggtcgtcagggggat
ccgggctcctcgcgtttctacctgtcgatggaagatgcgctgatgcgtatttttgcctct
gaccgcgtctccggcatgatgcgtaaactaggaatgaagccgggcgaagcgattgaacac
ccgtgggtgaccaaagcgattgccaacgcgcagcgcaaagtggaaagccgtaacttcgat
attcgtaagcagctgctggaatacgatgacgtcgccaacgatcagcgtcgcgcgatctac
acccagcgtaacgaactgctggatgtgtctgacgtgagcgaaaccatcaacagcattcgt
gaagatgtctttaaagcgaccatcgatgcctatattccgccgcagtctctggaggagatg
tgggatatccctggtttgcaggagcgtctgaaaaatgacttcgatctggatatgccgatc
gcggaatggctggataaagagccagaactgcatgaagagacgctgcgcgagcgtattctg
agccaggcgatcgaggtgtatcagcgcaaagaagaggtggttggcgcggagatgatgcgt
cacttcgaaaaaggcgtgatgttgcagactctcgactccctgtggaaagagcacctggcg
gcgatggactatctgcgtcaggggatccacctgcgtggctatgcgcagaaagatccgaag
caggagtacaagcgcgaatctttcgccatgttcgccgcgatgctggagtcgctgaagtat
gaagtgatcagcacgctaagcaaagtgcaggtacgtatgccggaagaggttgaagcgatg
gaactgcaacgtcgtgaagaggcggaacgtctggcgcagatgcagcagcttagccatcag
gacgaccatgctgcggccgctgctgacctggcggcgcaaaccggcgagcgcaaagtcggg
cgcaacgatccgtgcccttgcggttccggtaagaaatacaaacagtgccacggtcgtctg
agctga

DBGET integrated database retrieval system