KEGG   Citrobacter rodentium: ROD_01841
Entry
ROD_01841         CDS       T01145                                 
Symbol
lpxA
Name
(GenBank) acyl-[acyl-carrier-protein]--UDP-N-acetylglucos amine O-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
cro  Citrobacter rodentium
Pathway
cro00540  Lipopolysaccharide biosynthesis
cro01100  Metabolic pathways
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Module
cro_M00060  KDO2-lipid A biosynthesis, Raetz pathway, LpxL-LpxM type
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ROD_01841 (lpxA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_01841 (lpxA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cro01005]
    ROD_01841 (lpxA)
Enzymes [BR:cro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     ROD_01841 (lpxA)
Lipopolysaccharide biosynthesis proteins [BR:cro01005]
 Lipid A
  ROD_01841 (lpxA)
SSDB
Motif
Pfam: Acetyltransf_11 Hexapep
Other DBs
NCBI-ProteinID: CBG86964
UniProt: D2TI68
LinkDB
Position
217892..218680
AA seq 262 aa
MIDKSAFIHPTAIVEEGASVGANVHIGPFCLVGPHVEIGEGTVLKSHVVVNGHTKIGRDN
EIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQGGGLTKVGSDNLLMIN
AHVAHDCTIGDRCILANNATLAGHVSLDDYVIIGGMTAVHQFCIIGAHVMVGGCSGVAQD
VPPYVIAQGNHATPFGVNIEGLKRRGFTREAITAIRNAYKALYRSGKTLEEAKPDIAELA
KQHPEVQPFSDFFARSTRGLIR
NT seq 789 nt   +upstreamnt  +downstreamnt
gtgattgataaatccgcctttattcatccaaccgccattgtggaagaaggcgcctctgtc
ggcgctaacgttcatattggtcctttttgccttgttggaccccatgttgaaattggtgag
ggaaccgtactgaagtctcacgttgtcgtgaacggccacactaaaattggccgcgataac
gagatttatcagttcgcctccatcggtgaagtgaaccaggatctgaaatacgctggcgaa
cctacccgcgtggaaatcggcgatcgtaaccgtattcgcgaaagcgttaccattcatcgt
ggcacggtacagggcggtggattaacgaaggtgggcagcgataacctgttgatgatcaac
gctcatgtggcgcacgactgcacaataggcgatcgctgtattctggcgaataacgccacc
ctcgccggtcacgtttcgctggatgactatgtcatcatcggcggcatgaccgcggtgcat
cagttctgcattatcggggcgcacgtgatggtgggcggatgttccggcgtggctcaggac
gttccgccgtacgttatcgcccagggcaaccacgccacgccgtttggcgtgaacattgaa
gggctgaagcgccgcggctttacccgcgaagcgatcaccgcgattcgcaatgcctacaaa
gcgctgtaccgcagtggtaagacgctggaagaagcgaaaccggacatcgccgaactggcg
aagcagcacccggaagttcagccgttcagcgatttctttgcccgctcaacccgcggtctg
attcgttaa

DBGET integrated database retrieval system