KEGG   Citrobacter rodentium: ROD_02001
Entry
ROD_02001         CDS       T01145                                 
Symbol
cutF
Name
(GenBank) copper homeostasis protein (lipoprotein nlpE)
  KO
K06079  copper homeostasis protein (lipoprotein)
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_02001 (cutF)
SSDB
Motif
Pfam: NlpE_C NlpE Lipocalin_4
Other DBs
NCBI-ProteinID: CBG86980
UniProt: D2TI83
LinkDB
Position
235293..235994
AA seq 233 aa
MKKTLISAIAVLSLFTLFGCNNRSEVDVLQPTRAAELKPMQQSWRGILPCADCEGIETSL
FLEKDGTWVMNQRYLGAREEPSSFASYGTWARTADKLVLTDSNGEKTYYRAKGDSLEMLD
RDGNPIQSQFNYTLAPVKAILPVTPMAMRGMYFYMADAATFTDCATGRRVSVANNAELER
GYLAARGAGEKPVLLTVEGHFTLEANPDTGAPVKTLKADKEIKFISGQDCNSK
NT seq 702 nt   +upstreamnt  +downstreamnt
gtgaaaaagacactcatctccgcgatagccgtgctctcgctgtttacattatttggttgt
aataaccgttcagaagtggatgtactgcaaccgacccgggcggcggaactgaaaccgatg
cagcaaagctggcgcggcattttaccgtgcgctgattgcgaaggcattgagacgtcgctg
ttcctggaaaaagacggcacttgggtgatgaaccagcgctatctgggcgcgcgtgaagag
ccctcttcttttgcttcatacggcacatgggcgcgtaccgccgataagctggtcctgacc
gacagcaacggcgagaagacctattaccgggcgaaaggcgattcgctggagatgctcgat
cgcgacggtaatccgatccagtcgcagtttaattacacgcttgcgccggtgaaagcgatt
ctgccggtgacgcctatggcgatgcgcggcatgtatttttacatggcggatgcggcaacc
ttcaccgattgcgcgaccggcaggcgggtatcggtagcgaataacgcggagctggagcgc
ggataccttgccgcccgcggtgctggtgaaaaaccggtgttgctgacagtagaagggcac
ttcacccttgaggcaaacccggatacgggggcgccggtgaagacgctgaaggcggataaa
gagattaaatttatctcaggccaggactgtaacagtaaataa

DBGET integrated database retrieval system