KEGG   Citrobacter rodentium: ROD_06531
Entry
ROD_06531         CDS       T01145                                 
Symbol
mrdA
Name
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
cro  Citrobacter rodentium
Pathway
cro00550  Peptidoglycan biosynthesis
cro01100  Metabolic pathways
cro01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROD_06531 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_06531 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_06531 (mrdA)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ROD_06531 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ROD_06531 (mrdA)
SSDB
Motif
Pfam: Transpeptidase PBP_dimer
Other DBs
NCBI-ProteinID: CBG87428
UniProt: D2TNF9
LinkDB
Position
complement(714181..716082)
AA seq 633 aa
MKRQNSFRDYTAESALFVRRALVAFSGILLLTGVLIANLYNLQIVRYTDYQTRSNENRIK
LVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQHTLDALRSVVDLTDDDIAAFK
KERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKRRYYPYGSALTHVIGYVS
KINDKDIERLDKEDKLANYAATHDIGKLGIERYYEEVLHGQTGYEEVEVNNRGRVIRQLK
EVPPQAGHDIYLTIDLKLQQYIETLLAGSRAAVIVTDPRTGGVLSLVSMPSYDPNLFVDG
ISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSALSAGVITRNTSLFDPGWWQL
PGSEKRYRDWKKWGHGHLNVTKSLEESADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGID
LAEERSGNMPTREWKMKRFKKPWYQGDTIPVGIGQGYWTATPIQMSKALMILINDGVVKV
PHLLMSTAENGKQVPWVQPHEPPVGDIHSGYWELAKDGMYGVANRGNGTAHKYFASAPYK
IAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTAFAPYNNPQVAVAMILENGGAGPAV
GTIMRQILDHIMLGDNNTSLPAENPAVAAAEDQ
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgaaacgacagaactcttttcgcgactatacggctgagtccgcgctgtttgtgcgccgg
gcgctggtcgccttttcaggcatattgctgctcaccggcgtgctgatcgccaacctctat
aatctgcaaatcgtccggtataccgattatcagacccgctcgaatgaaaaccgcatcaag
ctggtgcctatcgcccccagccgcgggatcatctacgaccgtaacggcattccgctcgcc
cttaaccgcaccatctaccagattgaaatgatgccggagaaggttgataacgttcagcat
acccttgatgccctgcgcagcgtggtcgatcttaccgacgacgacattgccgccttcaaa
aaagagcgagcccgttcgcatcgtttcacctcgattccggtaaaaactaacctcaccgaa
gtgcaggtcgcacgatttgccgttaaccagtaccgtttccccggcgtcgaagtaaaaggc
tacaagcgccgctattatccttacggttcggcgctgacccacgtcatcggctatgtgtcg
aagatcaacgataaggacattgaacggcttgataaagaggacaagctggcgaattacgcc
gccacccacgatatcggcaagctggggattgagcgctactacgaagaggtactgcacggc
cagaccggttacgaagaggttgaagtcaacaaccggggccgcgttatccgccagcttaaa
gaggtgccgccgcaggccggacacgacatctaccttacgatagatttaaaactgcagcag
tatattgaaacgctgctcgccggaagccgggcggcggtgattgtgaccgatccccgcacc
ggcggcgtcctgtctctggtttccatgccaagctacgacccgaacctgttcgttgacggc
atctccagcaaagactattccgctctgcttaacgatccgaacactccactggttaaccgc
gccacgcaaggggtctacccgccagcgtcgacggtgaagccttacgttgccgtttccgcg
ctgagcgccggggtgattacccgcaataccagcctgtttgaccccggctggtggcagctg
cccggctcggaaaaacgctatcgcgactggaaaaaatggggccacggccatctgaacgtc
accaaatcgctggaggagtccgccgataccttcttctaccaggtcgcctatgacatgggg
atcgaccgcctttcggagtggatgggcaaattcggttatggccactataccggcatcgat
ctggcggaagagcgctccggcaacatgccaacccgcgaatggaagatgaagcgcttcaaa
aagccgtggtatcagggcgacaccatcccggtgggcatcggccagggctactggacggca
acgccgatccagatgagcaaagcgctgatgatcctgattaacgatggcgtggtgaaggtc
ccgcacctgctgatgagcaccgcagagaacggtaagcaagtgccgtgggtgcagccgcac
gaaccgccggtgggcgatatccactccggctactgggagctggcgaaagacggcatgtac
ggcgtggcgaaccgcggcaacggcacggcgcataaatattttgccagcgcgccctataag
attgcggccaaatccggtacggctcaggtcttcggcctgaaagccaatgaaacctataac
gcgcataaaattgccgaacgtctgcgcgaccacaagctgatgacggccttcgcgccctat
aacaacccgcaggtcgcggtcgccatgatcctcgaaaacggcggcgcaggtcccgcagtc
ggtacgattatgcgacagattcttgaccacattatgttgggcgataacaacaccagtctg
ccagcagaaaacccggcggttgcagcggcggaggatcaataa

DBGET integrated database retrieval system