KEGG   Citrobacter rodentium: ROD_07001
Entry
ROD_07001         CDS       T01145                                 
Symbol
kdpE
Name
(GenBank) two-component response regulator
  KO
K07667  two-component system, OmpR family, KDP operon response regulator KdpE
Organism
cro  Citrobacter rodentium
Pathway
cro02020  Two-component system
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_07001 (kdpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_07001 (kdpE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cro02022]
    ROD_07001 (kdpE)
Two-component system [BR:cro02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   ROD_07001 (kdpE)
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: CBG87474
UniProt: D2TNK4
LinkDB
Position
complement(768116..768793)
AA seq 225 aa
MTNVLIVEDEQAIRRFLRSALEGDGLRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDG
IDFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHA
SAPAPEPVVRFSDVTIDLAARLIHRGEKEIHLTPIEFRLLAVMLNNAGKVLTQRQLLNQV
WGPNAVEHSHYLRIYMAHLRQKLEQDPARPRHFITETGIGYRFMP
NT seq 678 nt   +upstreamnt  +downstreamnt
gtgacaaacgttctgattgttgaagatgaacaggccattcgccgctttctgcgcagcgcg
ctggaaggcgacgggctgcgcgtgttcgaagccgaaaccctgcagcgcggattgctggag
gcggcgacgcgtaaacccgatctcattattctcgatctcggtctgccggacggcgacggt
atcgattttattcgcgacctgcggcagtggagcgcggtcccggtgattgtgctttccgcc
cgcagcgaagagagcgacaaaatcgccgcgcttgatgccggcgccgatgactatctgagt
aaaccctttggcattggcgagctacaggcgcgcctgcgcgtggccctgcgccgccacgcc
tccgcgcccgccccagaaccggttgtgcgcttttccgatgtgacgatcgatcttgccgcg
cgtctgattcatcgcggcgaaaaggaaatccatctgacgccaatagagtttcgtttgctg
gccgtcatgctcaataacgccggaaaagtgctgacgcaacgacagctgttgaatcaggtc
tgggggccgaacgcggtcgagcacagccactatttgcgtatttatatggcccacctgcgg
caaaaactggagcaggatcctgcgcgcccgcggcattttattaccgaaaccggcattggc
tatcgctttatgccatga

DBGET integrated database retrieval system