Citrobacter rodentium: ROD_11561 Help Entry ROD_11561         CDS       T01145                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cro  Citrobacter rodentium Pathway cro01100   Metabolic pathways cro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ROD_11561 (acpP)    00074 Mycolic acid biosynthesis     ROD_11561 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ROD_11561 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  CBG87922 UniProt:  D2TTS8 LinkDB All DBs Position 1247503..1247739 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system