KEGG   Citrobacter rodentium: ROD_11691
Entry
ROD_11691         CDS       T01145                                 
Symbol
nagZ
Name
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cro  Citrobacter rodentium
Pathway
cro00520  Amino sugar and nucleotide sugar metabolism
cro01100  Metabolic pathways
cro01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ROD_11691 (nagZ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_11691 (nagZ)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ROD_11691 (nagZ)
SSDB
Motif
Pfam: Glyco_hydro_3
Other DBs
NCBI-ProteinID: CBG87935
UniProt: D2TTU1
LinkDB
Position
1260000..1261025
AA seq 341 aa
MGPVMLDVEGFELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALHGLEEGGRLAEEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERAYHADPAKALAMATRFIDGMHAAGMKTTGKHFPGHGAVTADSHKETP
TDPRPEAEIRAKDMSVFRALIGENKLDAIMPAHVIYSDVDSRPASGSPHWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGTFSRQELMDSPRWKQVSAQLSQLHERWQDQKAGH
NT seq 1026 nt   +upstreamnt  +downstreamnt
gtgggtccagttatgttggatgtcgaagggtttgagctggatgcggaagaacgggaaatt
ctggcccatccgctggtgggcgggttaatcctctttacccgcaattatcacgaccctgag
cagctacgcgaactggtgcgccagatccgcgcggcgtcgcgcaatcatctggtggtggcg
gtggatcaggaaggcgggcgcgtgcagcgttttcgcgaagggtttacccgtctgccagcc
gcccagtcgtttgccgcgctgcacgggctggaggaggggggcaggctggctgaagaggcc
ggatggctgatggccagcgaaatgattgcgatggatatcgacatcagcttcgcgccggtg
ctggacgtggggcatatcagcgcggcgattggcgagcgtgcttatcacgcggacccggcg
aaagcgctggcgatggcgacgcgttttattgacggtatgcatgccgcggggatgaaaacc
accggcaaacacttccccggtcatggcgcggtgaccgccgactcgcataaagagacgccc
accgatccgcgcccggaagcggaaatccgcgcgaaagatatgtccgtattccgcgcactg
atcggcgaaaataagctggatgcgattatgcccgctcatgtcatttacagcgatgtcgat
tcgcgcccggcaagcggttcgccgcactggctgaaaacggttctgcgccaggagctgggt
tttgatggcgtcattttctctgacgacctgtcaatggaaggggcggcgatcatgggcagc
tacgcggaacgtggacaggcgtcgctggatgcaggttgcgatatgatcctggtctgcaat
aatcgtaaaggggcggtgagcgtattagataatctgtcgccgatcaaagcagaacgtgtt
acacgtttgtatcataaaggtacattttcgcgtcaggaactgatggactcgccacgctgg
aaacaggtcagcgcgcagctcagccagttacatgaacgctggcaggatcaaaaagcaggt
cattaa

DBGET integrated database retrieval system