KEGG   Citrobacter rodentium: ROD_17071
Entry
ROD_17071         CDS       T01145                                 
Symbol
sapB
Name
(GenBank) peptide ABC transporter, permease protein
  KO
K19227  cationic peptide transport system permease protein
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
cro02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROD_17071 (sapB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_17071 (sapB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_17071 (sapB)
Transporters [BR:cro02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Cationic peptide transporter
    ROD_17071 (sapB)
SSDB
Motif
Pfam: BPD_transp_1 BPD_transp_1_N
Other DBs
NCBI-ProteinID: CBG88465
UniProt: D2TKC2
LinkDB
Position
1817714..1818679
AA seq 321 aa
MIIFTLRRLLLLMVTLFFLTFIGFSLSYFTPHAPLQGASLWNAWVFWFGGLLHWDFGVSS
INGQLISEQLKEVFPATMELCTLAFGFALMVGIPVGMLAGITRNKWQDRLISALALLGFS
IPVFWLALLLTLFFSLTLGWLPVSGRFDLLYEVKPVTGLAIVDAWLSDSPWRDEMVMSAL
RHMVLPVLTLAVAPTTEVIRLMRISTIDVFDQNYIKAAATRGLSRFTILRRHVLHNALPP
VIPRLGLQFSTMLTLAMITEMVFSWPGLGRWLINAIRQQDYAAISAGVMVIGSLVIIVNV
ISDILGAMANPLKHKEWYALR
NT seq 966 nt   +upstreamnt  +downstreamnt
atgattatcttcaccttgcgccgcctgctgctgctgatggtcacccttttcttcctgacc
tttatcggctttagcctgagctatttcacgccgcacgcgccgcttcagggcgcatcgctg
tggaacgcgtgggtcttctggtttggcggcctgcttcactgggacttcggcgtctccagc
attaacggtcagctcatctccgagcagcttaaagaggtctttcccgccacgatggagctg
tgtactctcgcctttggttttgcgctgatggtggggatcccggtcggtatgctggcgggc
atcacccgcaacaaatggcaggatcgtttaatcagcgccctcgccctgctcggcttctcg
attcccgtcttctggctggcgctgctgctgacgctgttcttttccctgacgctcggctgg
ctgccggtatcgggtcgcttcgatctgctatacgaagtgaaacccgtcaccgggctggcg
atcgttgacgcctggctctctgactctccctggcgcgatgagatggtgatgagcgcgctg
cgacatatggtgctgccggtgctgacgctcgcggtcgcaccgaccacggaagtgatccgc
ctgatgcgcatcagcaccattgatgtgtttgaccagaactatatcaaggcggcggcgacg
cgcggcctctccaggttcaccattctgcgccgccacgtcctgcataacgcgctgccgccg
gttatcccgcgccttgggctacagttttcaaccatgctgaccctggcgatgattaccgag
atggtctttagctggccggggcttggccgctggttaatcaacgccattcgccagcaggac
tatgcagcgatttcggcgggggtgatggtgatcggatcgctggtcattattgttaacgta
atttccgatattctgggtgctatggctaaccctctgaaacataaggaatggtatgcctta
cgatag

DBGET integrated database retrieval system