KEGG   Citrobacter rodentium: ROD_17091
Entry
ROD_17091         CDS       T01145                                 
Symbol
sapD
Name
(GenBank) peptide ABC transporter, ATP-binding protein
  KO
K19229  cationic peptide transport system ATP-binding protein
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
cro02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROD_17091 (sapD)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_17091 (sapD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_17091 (sapD)
Transporters [BR:cro02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Cationic peptide transporter
    ROD_17091 (sapD)
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA AAA_16 BrxC_BrxD AAA_29 Sigma54_activat NB-ARC
Other DBs
NCBI-ProteinID: CBG88467
UniProt: D2TKC4
LinkDB
Position
1819556..1820548
AA seq 330 aa
MPLLDIRNLTIEFKTGDEWVKAVDRVSMTLSEGEIRGLVGESGSGKSLIAKAICGVAKDN
WRVTADRMRFDDIDLLRLSPRERRKLVGHNVSMIFQEPQSCLDPSERVGRQLMQNIPAWT
YKGRWWQRFGWRKRRAIELLHRVGIKDHKDAMRSFPYELTDGECQKVMIAIALANQPRLL
IADEPTNAMEPTTQAQIFRLLTRLNQNSNTTILLISHDLQMLSQWADKINVLYCGQTVET
APSRELVTMPHHPYTQALIRAIPDFGSAMPHKSRLNTLPGAIPLLEQLPIGCRLGPRCPY
AQRECIETPRLTGPKNHLFACHFPLNMERE
NT seq 993 nt   +upstreamnt  +downstreamnt
atgccgttactcgatatccgcaatttgaccattgaatttaaaaccggcgacgagtgggtg
aaagccgtcgaccgcgtcagcatgaccttaagcgagggggaaattcgcgggctggtgggc
gaatccggctccggcaaaagcctgatcgcgaaagccatctgcggcgtggcgaaagataac
tggcgcgtcaccgccgatcgcatgcgctttgacgacattgacctgctgcgcctctccccg
cgcgaacgccgcaagctggtggggcataacgtgtcgatgattttccaggagccgcagtcg
tgtcttgacccgtcggaacgtgtcgggcggcagttaatgcaaaacatccccgcctggacc
tacaagggccgttggtggcagcgtttcggctggcgcaagcgccgggccattgaactgctg
caccgcgtggggattaaagatcataaagatgcgatgcgcagcttcccgtatgagttgacc
gacggcgaatgtcaaaaggtgatgatcgccattgcgctggcaaaccagccgcgcctgctg
atcgccgatgagccgacgaacgcgatggaaccgaccacccaggcgcaaattttccgcctg
ctgacgcgtttaaaccagaacagcaataccaccattttgctgatcagccacgacctgcaa
atgctcagccagtgggcggataaaattaacgtgctgtactgtgggcaaacggttgaaacc
gcgccgagcagagagctggtgaccatgccgcaccatccgtacacgcaggcgctgatccgc
gcgatccctgactttggcagtgccatgccgcataaaagtcgtctgaataccttgccgggg
gccatccctctgctggagcaattaccgataggctgccgtctggggccgcgctgcccgtat
gcgcaacgagaatgcattgagacgccacgtctgaccggaccgaaaaaccatcttttcgcc
tgtcatttcccgctgaacatggagagagagtga

DBGET integrated database retrieval system