KEGG   Citrobacter rodentium: ROD_25141
Entry
ROD_25141         CDS       T01145                                 
Symbol
lepB
Name
(GenBank) signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
cro  Citrobacter rodentium
Pathway
cro03060  Protein export
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_25141 (lepB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cro01002]
    ROD_25141 (lepB)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     ROD_25141 (lepB)
Peptidases and inhibitors [BR:cro01002]
 Serine peptidases
  Family S26: signal peptidase I family
   ROD_25141 (lepB)
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: CBG89257
UniProt: D2TU25
LinkDB
Position
complement(2649879..2650853)
AA seq 324 aa
MANMFALVLVIATLVTGVLWCVDKFFFAPKRRERQAAAQAATGDSLDNATLKKVAPKAGW
LETGASVFPVLAIVLVVRSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTL
IETGHPKRGDIVVFKYPDEPKLDYIKRAVGLPGDKVTYDPIAKEVTIQPGCRSGQACGNA
LPVTYSDVEPSDFVQTFKRRNGGEASSGFFEVPQNETKENGIRLAERKETLGEVTHRILT
VPIAQDQVGMYYRQPGQQLATWIVPPGHYFMMGDNRDNSADSRYWGFVPEANLVGKATAI
WMSFDKQEGEWPTGVRLSRIGGIH
NT seq 975 nt   +upstreamnt  +downstreamnt
atggcgaatatgtttgccctggttctggtgattgccacactggtaacgggcgttttatgg
tgcgtcgataaattctttttcgcgcccaaacgtcgggaacgtcaggcggcggcgcaggct
gcgaccggcgattcgctggataacgccacgctgaaaaaagtggcgccgaaagcgggctgg
ctggaaaccggcgcgtcggtatttccggtgctggcgattgtgctggtggtgcgttcgttc
atttacgagcctttccagatcccgtcaggttcgatgatgccgacgctgttaatcggcgat
tttatcctggtggagaaattcgcctacgggattaaagatccgatctaccagaaaaccctg
attgaaaccggacacccgaaacgcggcgatattgtggtctttaaatatccggacgagccg
aagctggactacatcaagcgggccgttggactgccgggcgataaagtgacttacgatccg
atcgccaaagaggtcaccattcagccgggatgccgctctggtcaggcgtgcggcaacgcg
ctgccggtcacctatagcgacgttgagccgagcgatttcgtgcagaccttcaagcggcgt
aacggcggcgaggccagcagcggctttttcgaggtgccgcagaacgaaaccaaagagaac
ggcattcgtcttgccgagcgtaaagagacgcttggcgaggtaacgcaccgcattctgacc
gtgccgattgcccaggatcaggtggggatgtattaccgtcagccggggcaacagctggca
acgtggatcgtcccgccgggacactacttcatgatgggcgacaaccgcgataacagcgcc
gacagccgttactggggattcgtaccggaagcgaacctggtaggtaaagcgaccgctatc
tggatgagcttcgataagcaggaaggtgaatggccgaccggcgttcgcctgagccgcatt
ggcggtatccattaa

DBGET integrated database retrieval system