KEGG   Citrobacter rodentium: ROD_27671
Entry
ROD_27671         CDS       T01145                                 
Symbol
cts1G
Name
(GenBank) VgrG family T6SS protein Cts1G
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_27671 (cts1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_27671 (cts1G)
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_27671 (cts1G)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF6484
Other DBs
NCBI-ProteinID: CBG89511
UniProt: D2THS9
LinkDB
Position
complement(2917403..2919745)
AA seq 780 aa
MSRTITLSSPAMPLLLGDTALVISKLDGEEALSSLYSYVITAKTPANPLIPWQAASNVDL
KALIGKEMTVTIELDGNGLGDIFAIGKDTREISGIVQRARYIGRDSNQALYEIVIRPWLH
LAELTTDFKIFQKKTVVDIIDEVLGDYNFPLEKRLAGSYPLLDFQVQYGESDFNFIERLM
EEWGIYWFFEHAEQYHKLILVDNVGAHKRFPSEAYHVVQYAADRPKMDQEYISQFHFQET
ITSGKWVTNDYDFTKSRADIMALDSKPRKTSFNEMEIFHWPGDYEQPNIGEQLARVRMEE
RGALGSRCEGSGELRGIACGCDFELVNYPVEKANREYMILRSHLVVEEINQVTDVDEFRY
HCDFTVQPTTKIYRHPMTVPRPKTSGPQTAIVVGPDGEEIWTDEYGRVKVRFLWDRYGKN
RESDSCWLRVSQAWAGNNFGGIYIPRIGHEVIVDFINGDPDRPLIIGSLYNNVTMPPWDL
PVNATQSGLVSRTVGGGRSNFNGIRFEDKPGLEQYWEQAERNMTRLTKQNEEQTIGMNSN
VNVGLSRNLFVGANYMSDVVGNSSAIIGGALAIQVGGGQTDNVALAKGINVGGAFMTTVG
GYHSLAVGGASTTVAGGAMTLTAGGELVLSAKKIKIVGSEQVIIQGGTVELNPGDCSDNC
GGGGGGGGAMIGLPGLPAIPSLFGVVLPLPLLPTPTPAPTTSTDTPTESPTETPTETPTE
TPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETGNAIPEP
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgtcacgtactattacattaagcagtccggcgatgccgttattgctgggcgataccgct
ctggttatctctaagctggatggcgaagaggcgctgtcgtccctgtactcctatgtgatt
acggctaaaaccccggctaaccctttaattccctggcaggccgcatcgaatgtcgattta
aaagcattaatcggcaaagaaatgaccgtcaccattgaactggatggtaacggattgggg
gatatttttgccattggtaaagatacccgggaaatatcaggaattgtgcaacgtgcgcgt
tatatcggacgcgatagtaatcaggcgctctatgaaattgtgattcgcccatggctgcat
ctggcagaactgactacggattttaaaatattccagaaaaaaaccgtggtggatattatt
gatgaggtgttaggcgattacaatttcccgttagaaaaaaggctggcgggaagctatccg
ctgctggatttccaggttcagtatggtgaaagcgactttaattttattgaacggttaatg
gaagagtgggggatttattggttctttgaacatgccgaacagtaccacaaactgattctg
gtggataacgtcggggcgcataaacgtttcccgagtgaagcttatcatgtggttcagtac
gcagccgatcgtccgaagatggaccaggaatatatcagccagtttcattttcaggaaacc
attacctccgggaaatgggtcaccaatgattatgattttacgaaatcacgtgccgatatt
atggcgctggacagcaagccgcgtaaaaccagttttaacgagatggagatcttccactgg
ccaggcgattacgagcagcccaatatcggtgagcagctggcgcgggtacgaatggaagaa
cgcggggcgctggggtcacgctgcgaaggttccggtgaactgcgcggaattgcctgcggg
tgcgattttgaactggtgaattaccccgtcgagaaagcgaaccgcgaatacatgattttg
cgaagccatctggtggtggaagagattaatcaggtgaccgacgtggacgaattccgttat
cactgcgattttaccgttcagccaaccaccaagatttatcgccacccgatgacggtgccc
aggccgaaaaccagcggaccgcaaacggctatcgttgtgggtcctgatggcgaagagatc
tggaccgacgaatatggccgcgtaaaggtacgttttttgtgggatcgctacggtaaaaac
cgggagtccgactcctgctggctacgtgtgagccaggcctgggccggaaataactttggc
gggatctatattccccgtatcggccatgaagtgattgtcgactttattaacggcgatcct
gaccgaccgctgattatcggcagcctgtacaacaacgtaacgatgccgccgtgggatctg
ccggtgaacgctacgcagagcgggctggttagccgcaccgttggcggtgggcgcagcaac
tttaacggcattcgctttgaagataagcccgggcttgagcagtactgggaacaggccgag
cgcaatatgactcgtttaaccaagcaaaacgaggagcagaccatcggcatgaattccaac
gtgaatgtcggtctgtcacgaaatctgttcgttggcgcgaactatatgtcggatgtggtc
ggcaacagtagcgccatcatcggcggcgcgctggccattcaggtgggcggaggccagacc
gataacgttgcgctggcaaagggaattaacgtcggcggcgcgtttatgacgaccgttggc
ggctatcactcgctggctgtcggcggcgcaagcaccaccgttgcgggaggggcgatgacg
ctcactgcaggcggtgaactggtgctctcggcgaagaagatcaaaatcgtcggttccgaa
caggtcattattcagggcggcacggtcgagcttaaccctggcgactgcagcgataactgc
ggcggcggcggtgggggcggtggcgcaatgattggcctgccgggcctgcctgcgattcca
tcgctgtttggcgttgtgcttccgttaccgctgcttccgacgccaacgcctgcgcctacg
acatcaacggacacgccaacggaatccccgacggagacgccaacagaaaccccaacggag
acgccaacggaaaccccgacggagacgccaacggaaaccccgacggagacgccaacggaa
accccgacggagacgccaacggaaactccgacggagacgccaacggaaaccccgacggaa
accccaacagagacaccaacggaaaccccgacggagacaggcaacgcaattcctgaacct
taa

KEGG   Citrobacter rodentium: ROD_28191
Entry
ROD_28191         CDS       T01145                                 
Name
(GenBank) putative Rhs protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_28191
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_28191
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_28191
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C DUF6484 T6SS_Vgr
Other DBs
NCBI-ProteinID: CBG89561
UniProt: D2TIK2
LinkDB
Position
2980896..2982974
AA seq 692 aa
MAEKGLRFTLEVEGQPPETFAVVSFRLVQDYSVPFTLDVDVAGEGFRLTPEALLEKEAVL
TILTGATMQRRMRGIVTHFGIRDYNGWQIRHQLIIRPPLWRAGLRQNFRIFQQQDIQSIT
ATLLDENGVTDWTPCFYEHHPPREFCVQYGETDLAFLTRLWSEEGIFFFERQAHEGDKQT
LVLCDNAAGLTTAGDMPFNPNHTTEAFTRCISAFSYLAQIRPSSVSTRDYTFKAPSWPGC
FDREGDNLNGQYRQYEIFDYPGRFKDEQHGQDFARYQAEGWRSNAETASGESHSPALWPG
AQVTLTGHPVPPLNRAWQIISSTLTGKQPQALKGSRGPGTTLDNQFSVIPGDRTWRPQPL
LKPKVDGPQPAVVTGPPGEEIFCDEHGRVRVKFIWDRYHGENEDSSCWIRVSQAWAGAGF
GNLAVPRVGQEVIVDFLNGDPDQPLIMGRTYHEDNRSPGDLPGTRTQMTIRSKTYQGSGF
NELRFEDATGQEQVYIHAQKNMDTEVLNNRSTDVKVNHTETIGGNQVITVKQNQMQTVVQ
NQQENIGQNQSVTVGLNQAETVGVARALTVGVAYQTTVGGMMNTSVALMQASQVGIQKSL
LVGKGYDVSVGENVTFTVGKNRQESAGRVAVYSAGEHLELRCGQARLVLTQDGSIFLNGT
AINLQGVQTISGDSLMINWNCGATKNPPDAPE
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggcagagaaaggactgcgtttcacgctggaagtggaaggacagcccccggaaaccttt
gcggtggtcagcttccggctggttcaggattattccgttccctttacgcttgacgtggat
gttgccggtgagggcttccggctgacgccggaagccctgctggagaaagaggccgtgctg
actatcctgaccggcgccacaatgcagcgccgtatgagggggattgtcacccatttcggc
atccgtgattacaacggatggcagatccgccatcagttgatcatccgtccgccgttatgg
cgcgccgggctgcgacagaacttccgcatcttccagcagcaggatattcagtccattact
gccacattactggacgaaaacggcgtcaccgactggacgccctgcttttatgagcatcat
ccgccccgtgaattctgcgttcagtacggcgaaaccgacctggcatttctgacacgactg
tggtcagaggaaggcattttcttttttgagcgccaggcgcacgaaggcgataaacagacg
ctggtgctgtgcgacaatgccgccggattaaccaccgcaggcgacatgccgtttaatccc
aaccataccaccgaagccttcacccgctgtatcagcgccttcagctatctggcgcagata
cgcccctcgtcggtcagtacccgggactatacctttaaggccccctcctggccgggatgt
ttcgaccgtgaaggcgataacctgaacggtcagtacaggcagtatgagatttttgattac
ccgggccgctttaaggatgagcagcacggtcaggatttcgcccgctatcaggcggaaggc
tggcgcagcaacgccgaaaccgccagcggcgaaagccactccccggcgctgtggccgggc
gcgcaggtcacgcttaccggacatccggtccctccactgaaccgggcctggcagatcatc
agcagtacattgacgggaaaacagccgcaggcgctgaaaggcagccgcggtccgggcacc
acgctggataatcagttcagcgttattcctggggacagaacatggcgaccccagccgctg
ctgaagccgaaagtcgatggtccgcagcctgccgtggtgaccggaccgccgggcgaagag
atcttttgcgatgaacatggccgggtacgggtgaaatttatctgggaccgctatcacggc
gaaaacgaagacagttcctgctggatacgggtgtcacaggcgtgggcaggcgcgggattt
ggtaatctggcggttccccgcgtcggtcaggaagtgattgtggacttcctcaacggcgac
ccggaccagccgcttatcatggggcgaacctatcatgaagataaccgttcgccgggagat
ttacccggaaccagaacgcagatgaccatccgttcaaaaacgtatcagggcagcggcttt
aatgaactgcggtttgaggatgcgaccggacaggaacaggtgtatatccatgcgcagaag
aacatggataccgaagtgctgaacaaccgcagtaccgacgtgaaggtcaaccacacggaa
accatcggcggaaaccaggttatcacagtgaaacagaaccagatgcagacggtggtgcag
aaccagcaggagaatatcggccagaatcagtccgtcaccgtcgggctgaaccaggcggaa
acggtgggcgtggcccgtgccctgacggtcggagtggcgtatcagaccacggtgggcggc
atgatgaacacctcagtggcgctgatgcaggcttcgcaggtgggaatacagaaatcgctg
ctggtcggtaaaggatatgacgtcagcgtcggggaaaatgtcacatttacggtggggaaa
aaccggcaggaaagcgcaggcagggtcgccgtttactccgccggcgagcatctggaactg
cgctgcgggcaggcgcggctggtgctgacgcaggacggcagcatctttctgaacggcacg
gcgattaatttgcagggagtgcagaccatcagcggcgattcgctgatgattaactggaac
tgcggcgcgacaaaaaatcctccggatgcgccggagtag

KEGG   Citrobacter rodentium: ROD_34241
Entry
ROD_34241         CDS       T01145                                 
Symbol
cts2G
Name
(GenBank) VgrG family T6SS protein Cts2G
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_34241 (cts2G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_34241 (cts2G)
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_34241 (cts2G)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C DUF6484 DUF3540 Imm10
Other DBs
NCBI-ProteinID: CBG90137
UniProt: D2TPV2
LinkDB
Position
3606559..3608523
AA seq 654 aa
MSDTAIIRLSAPLLTGLTVSSAQTESQLNALTTATVAGTSCAPLTLDSALATHLTATINN
ADYDGLIAGAYQLPATGNADRYQFVLRPWLWWLTLSSNNRVFQNLNVQEIVGNIFKDAGF
SDYKFQLKTTPVKREYCLQYNESDFNFVSRLLEQEGIFWFFTHQEGKHTLVLADDNSAFP
PIPGDKKVKYQAAQSGEREIGAIRSAELRLQATAQGFQSSDYNYEQPKAPLFSWAGEQKG
GMHYQHPGRFSAKDAGDALAAWKVNALKTQAKQLVGESDCAALMAGHWFTLTDHDDKSLN
IDWLIIAVNHEYDGSRYHNRFTAIPKSTPYRPLSATPAPFMHTQTATVVGKSGEEIWTDK
LGRVKVQFPWDREGNNNETSSCWLRVATAWSGNGFGAQFIPRIGQEVVVSFIDGDPDKPL
ITGCVYNGANALPYALPANQTQSGIKTKSEKGFNELRFDDKKDAELLAMQAQKDFHLMVL
NDSKTTIGHDEIHSVKNDRTHTVEEGNETVTVKKGHRTVKIEKGSDTLEVKDKRSVTVEG
DQEHAVEGNETHKVKGNYTLNVDGNLTIKVNGTLTLESGKNLEVKSGANLNARASASLKM
NATSIASEAESSLTQKAATISQEAKATLTSKASATQTVDGGGMLVIKGGMVKIN
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgtccgataccgccattatcagactcagcgctccattgctgaccggcctgactgtctcc
tcagcgcagactgaatcacagctcaacgcgctcactaccgccaccgtcgcaggaaccagc
tgtgcgccgttaacgttagacagcgcgctggcaacccatctgaccgccacgataaacaat
gccgactacgatgggctgattgccggggcgtaccagcttccggcgaccggtaacgctgac
cgctatcagtttgtgttacgtccgtggttgtggtggctgacgctctccagcaataaccgc
gtttttcagaacctgaacgttcaggagattgtcggaaatatatttaaagatgcaggtttt
tccgattataaattccagcttaaaaccacaccggtgaagcgtgaatactgtctgcaatat
aatgaaagcgactttaattttgtttcccgtctgctggagcaggaggggatcttctggttc
ttcactcatcaggaaggtaagcatacgctggtgctggctgacgataacagcgccttcccg
ccgattccaggcgacaaaaaggtaaaatatcaggctgcgcagagcggtgagcgggaaatc
ggggcgattcgctcggcagagctgcgtttacaggctaccgctcagggcttccagagcagc
gattataattacgagcagccgaaagcgccgctgttctcctgggcgggtgaacagaagggg
ggcatgcactatcagcatccggggcgctttagcgccaaagacgctggcgatgcgctggcg
gcgtggaaggttaatgcgctgaagacgcaggcgaaacagctggtaggtgaaagcgactgc
gcggcgctgatggccgggcactggtttacgcttaccgatcatgacgacaaatccctgaac
atcgactggctgattatcgcggttaaccatgaatatgatggttcccgataccataaccgt
tttaccgccattccgaagtccacgccgtatcgtccgctgtccgcgacgcctgcgccgttt
atgcatacgcaaacggcgacggtggttggcaaaagcggcgaagagatctggaccgacaaa
cttgggcgggtaaaagtgcagttcccgtgggacagagaaggcaataataacgaaaccagc
tcctgctggttacgggtagctaccgcctggagcggcaacggatttggcgcgcagtttatc
ccgcgtatcggccaggaggtcgtcgtgagctttatcgacggcgacccggataagccgttg
ataacaggctgcgtctacaacggcgcgaatgccttgccgtatgcgctgccggcaaaccag
acccagtccggcattaaaacgaaaagtgaaaaaggcttcaatgaactgcgcttcgacgac
aaaaaagacgccgagttactggctatgcaggcgcagaaagattttcatcttatggtgctt
aacgacagcaaaaccaccatcggccacgatgagattcacagcgtcaaaaacgatcgcacc
cacaccgttgaagaggggaacgaaaccgtcaccgtgaaaaaaggtcaccggacggtaaaa
atcgagaagggtagcgacacgctggaggtgaaggacaagcgcagtgtgacggtggagggc
gatcaggaacacgcggtggagggtaacgaaacgcataaggtaaaaggcaactataccctc
aatgttgacggcaatctgaccattaaggtaaacggcacgctaaccctggaaagcggtaaa
aatttggaggtgaagagcggggcaaatcttaacgccagagcttcggccagcctgaaaatg
aacgccactagcattgccagcgaagcagaatcctctttgactcagaaagccgccaccatt
agccaggaagcgaaagcgaccctgaccagcaaagccagcgccacccagaccgtagacggc
ggcggtatgttggtgattaaaggcgggatggtgaagatcaactga

DBGET integrated database retrieval system