KEGG   Citrobacter rodentium: ROD_34831
Entry
ROD_34831         CDS       T01145                                 
Symbol
basR
Name
(GenBank) two-component response regulator
  KO
K07771  two-component system, OmpR family, response regulator BasR
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
cro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_34831 (basR)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_34831 (basR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cro02022]
    ROD_34831 (basR)
Two-component system [BR:cro02022]
 OmpR family
  BasS-BasR (antimicrobial peptide resistance)
   ROD_34831 (basR)
SSDB
Motif
Pfam: Response_reg Trans_reg_C NgoMIV_restric
Other DBs
NCBI-ProteinID: CBG90197
UniProt: D2TQR2
LinkDB
Position
complement(3677148..3677822)
AA seq 224 aa
MKILIVEDDTLLLQGLILAAQTEGYACDGVSTARAAEQCLESGHYSLVVLDLGLPDEDGL
HFLARIRQKKYTLPVLILTARDTLTDKISGLDVGADDYLVKPFALEELHARIRALLRRHH
NQGESELTVGDLTLNMGRRQVWKAGEELVLTPKEYALLSRLMLKAGSPVHREILYNDIYN
WDNEPSTNTLEVHIHNLRDKVGKSRIRTVRGFGYMLVATATEES
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaaaatattgattgtggaagacgatacgctgttgttgcagggactgatcctggcggcg
caaacggaagggtacgcctgcgacggcgtctctaccgcccgcgcggcggagcaatgtctg
gagagcggccactacagtctggtggtgctggacctcggcctgccggatgaagacggcctg
cacttcctggcgcgtatccggcagaaaaaatataccctgccggtgctgatcctgaccgcc
cgcgacacccttaccgacaaaatttccgggctggacgtcggcgccgacgactatctggta
aaacccttcgcgctggaggagctgcacgcccgcatccgcgcgctgctgcgccgccatcat
aatcagggcgaaagcgaactgacggtcggcgatttgaccctcaatatgggacgtcggcag
gtgtggaaagcgggtgaagagctggtgctcacgccaaaagagtacgccctgctctcaagg
ctgatgctgaaggccggtagcccggtgcatcgggaaattctctataacgacatttataac
tgggacaacgaaccttccaccaacaccctggaagtgcatattcataatctgcgcgacaag
gtcggcaagtcgcgtattcgcaccgtgcgcggctttggctatatgctggtggcgaccgca
acggaggaaagctaa

DBGET integrated database retrieval system