KEGG   Citrobacter rodentium: ROD_37711
Entry
ROD_37711         CDS       T01145                                 
Symbol
secE
Name
(GenBank) preprotein translocase SecE subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
cro  Citrobacter rodentium
Pathway
cro02024  Quorum sensing
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_37711 (secE)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_37711 (secE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_37711 (secE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_37711 (secE)
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_37711 (secE)
SSDB
Motif
Pfam: SecE
Other DBs
NCBI-ProteinID: CBG90476
UniProt: D2TTH7
LinkDB
Position
complement(3965425..3965808)
AA seq 127 aa
MSANTEAQGSGRGLEAIKWIVVVALLLVAIVGNYLYRDMMLPLRALAVVILIAAAGGVAL
LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS
FITGLRF
NT seq 384 nt   +upstreamnt  +downstreamnt
atgagtgcgaataccgaagctcaaggaagcgggcgcggcctggaagcgataaagtggatc
gttgtcgtggcgttgctgctcgtggcaattgtcggcaattatctttatcgtgacatgatg
ctgccgctgcgtgcgctggccgtagtaattctgattgctgcagcgggtggtgtcgcgctg
ttgacgacgaaagggaaggcaaccgttgcttttgcccgcgaagcgcgtacagaagtacgt
aaggtcatttggccgactcgccaggaaacgttgcacaccacgctgattgtggctgcggtt
accgcagtaatgtcactaatcctgtggggactggatggtattctggttcgcctggtttcc
tttatcactggcctgaggttctga

DBGET integrated database retrieval system