KEGG   Citrobacter rodentium: ROD_39161
Entry
ROD_39161         CDS       T01145                                 
Symbol
tatC
Name
(GenBank) Sec-independent protein translocase protein
  KO
K03118  sec-independent protein translocase protein TatC
Organism
cro  Citrobacter rodentium
Pathway
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_39161 (tatC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_39161 (tatC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_39161 (tatC)
Secretion system [BR:cro02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   ROD_39161 (tatC)
SSDB
Motif
Pfam: TatC
Other DBs
NCBI-ProteinID: CBG90619
UniProt: D2TUZ5
LinkDB
Position
complement(4135553..4136338)
AA seq 261 aa
MAVEDTQPLITHLIELRKRLLYCIVAVIAIFVALVYFANDIYHLVSAPLIKQLPHGATMI
ATDVASPFFTPIKLTFMVSLILSAPVILYQVWAFVAPALYKHERRLVVPLLISSSLLFYI
GMAFAYFVVFPLAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCW
VGITTPEDLRKKRPYVLVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEVGVFFARFYVGKR
VSRDEDNEAEAEAEKAGKTEE
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctgtagaagatactcaaccgcttatcacgcatctgattgagctgcgcaaacgcctg
ctttactgcattgtcgcagttatcgcgatcttcgtggcattggtttattttgccaatgac
atctatcacttggtttccgcgccgctgattaaacagttgccacatggggcgaccatgatc
gcgacggatgtcgcctcaccgtttttcacccccatcaaactgacctttatggtgtcgctg
atcctgtcagcgccggtcattctttatcaggtctgggcgtttgttgcgccagcgctgtat
aagcatgaacgccgtctggtcgtgccgctgctgatctccagctctttgctgttctacatc
ggtatggcgtttgcctactttgtggtctttccgctggcgtttggctttctggccaacacc
gcgccggaaggggtacaggtttcgaccgatatcgccagctacctgagtttcgtcatggcg
ctgtttatggcgtttggcgtctcttttgaagtgccggtcgccatcgtcttgctgtgctgg
gtcggcattaccactccggaagatttgcgtaaaaaacgtccttacgtactggttggcgcg
tttgtcgtggggatgctgctgacgccgccggacgtcttctcgcaaacgctgctggcaata
ccgatgtactgcctgtttgaggtcggcgttttcttcgcgcgtttctatgtcggaaagcga
gtttcgcgggatgaagacaacgaggcggaagcagaagctgagaaagccggaaagacagaa
gagtaa

DBGET integrated database retrieval system