KEGG   Citrobacter rodentium: ROD_40241
Entry
ROD_40241         CDS       T01145                                 
Symbol
oxaA
Name
(GenBank) inner membrane protein
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
cro  Citrobacter rodentium
Pathway
cro02024  Quorum sensing
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_40241 (oxaA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_40241 (oxaA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_40241 (oxaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cro03029]
    ROD_40241 (oxaA)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_40241 (oxaA)
Mitochondrial biogenesis [BR:cro03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    ROD_40241 (oxaA)
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_40241 (oxaA)
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP
Other DBs
NCBI-ProteinID: CBG90727
UniProt: D2THC2
LinkDB
Position
complement(4259884..4261527)
AA seq 547 aa
MDSQRNLLIIALLFVSFMIWQAWEQDKNPQPQTQQTTQTTTTAAGSAADQGVPASGQGKL
ITVKTDVLDLTINTRGGDVEQALLPAYPKELGSSEPFQLLETTPQFIYQAQSGLTGRDGP
DNPANGPRPLYNVEKDTFVLADGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV
LNAGAKPLEISTFGQLKQSINLPSHRDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD
NENLNVNANGGWVAMLQQYFATAWVPRNDGTNNFYTANLGNGVAAIGYKSQPVLVQPGQT
GAMTSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFLGNWGFSIIV
ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRQSQEMMALYKAEKVNPL
GGCFPLIIQMPIFLALYYMLMGSIELRHAPFALWIHDLSAQDPYYILPILMGVTMFFIQK
MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL
HSREKKS
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggattcgcaacgcaatcttcttatcatcgctttgctgttcgtgtctttcatgatctgg
caagcctgggagcaggataaaaatccgcaacctcagacccaacagaccacgcagacaacg
accaccgcagcgggtagcgccgccgaccagggcgtaccggccagtggccaggggaaactg
attacggttaagaccgacgtacttgatctgaccattaacacccgtggcggtgatgtggaa
caggccctgctgccagcttatccgaaagaactcggttccagcgaaccgttccagctgctg
gaaaccaccccgcagtttatctatcaggcacagagcggcctgaccggtcgtgatggcccg
gataatccggctaacggcccgcgtccgctgtacaacgttgaaaaagatacgtttgtgctg
gccgacggtcagaacgagctgcaggttccgatgacgtataccgacgctgcgggcaatacg
tttactaaaacgtttgtcctcaaacgtggcgattatgcggttaacgtcaactacaacgtg
ctgaacgccggcgcgaaaccgctggaaatctccacctttggccagttgaagcaatccatc
aatctgccgtctcatcgcgataccggaagcagcaacttcgcgctgcataccttccgtggc
gcagcgtactccacgccggatgagaagtatgagaaatacaaattcgacaccatcgccgat
aacgaaaacctgaacgtcaacgccaacggcggctgggtagcgatgctgcaacagtatttc
gccaccgcgtgggttccgcgtaacgacggcaccaacaacttctataccgcgaatctgggt
aacggcgtggcggctatcggctataaatctcagccggtactggtacaacctggccagact
ggcgcgatgaccagcaccctgtgggtcggcccggaaattcaggataaaatggcggccgtt
gcaccgcacctggatctgaccgtggattacggctggttgtggttcatctctcagccgctg
tttaaactgctgaagtggatccatagcttcctgggtaactggggcttctccatcatcgtt
atcacctttatcgttcgtggcatcatgtacccgctgaccaaagcgcagtacacctccatg
gcgaagatgcgtatgctgcagccgaagattcaggctatgcgtgagcgtctgggcgatgac
aaacagcgtcagagccaggagatgatggccctgtacaaagctgagaaggttaacccgctg
ggcggctgcttcccgctgattatccagatgccaatcttcctggcgttgtactatatgctg
atgggctccattgaactacgccatgcgccgttcgctctgtggatccatgacctgtccgca
caggacccgtactacatcctgccgatcctgatgggcgtgacgatgttcttcatccagaag
atgtcgccgaccaccgtgaccgacccgatgcagcagaagatcatgacctttatgccggtc
atcttcaccgtgttcttcctgtggttcccgtcaggtctggtgctgtactatatcgtcagc
aacctggtgaccatcatccagcagcagctgatttatcgcgggctggaaaaacgtggtctg
catagccgcgagaaaaagtcttaa

DBGET integrated database retrieval system