KEGG   Citrobacter rodentium: ROD_43571
Entry
ROD_43571         CDS       T01145                                 
Symbol
ftsY
Name
(GenBank) cell division protein
  KO
K03110  fused signal recognition particle receptor
Organism
cro  Citrobacter rodentium
Pathway
cro02024  Quorum sensing
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_43571 (ftsY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_43571 (ftsY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_43571 (ftsY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_43571 (ftsY)
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_43571 (ftsY)
SSDB
Motif
Pfam: SRP54 SRP54_N Zeta_toxin AAA_30 AAA_22 AAA_17 APS_kinase AAA_33 ABC_tran AAA_16 Thymidylate_kin AAA_24 AAA CbiA AAA_31 DUF2075 MeaB YqeC NTPase_1 AAA_14 PIF1 TrwB_AAD_bind AAA_19 MMR_HSR1 AAA_5 Macoilin
Other DBs
NCBI-ProteinID: CBG91054
UniProt: D2TKU0
LinkDB
Position
4603618..4605102
AA seq 494 aa
MAKQKKRGFFSWLGFGEKEQQEQKPEEQQLEEEQRPAETSVDTAADVEAEAPAHSKEETE
TFAQDVVEVTEQIQESEKPQPVEPEPVAVVEPEQVVAPQVAVEREVLPLPEEVKAEETSP
EEWQAEAETVEIVNAVEEEAQNVPPLSDEELEAQALAAEAAEEAVLVVPVAEEETPVDEI
AQEQEKPTKEGLFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVE
TTRKIIANLTEGASRKQLRDAEALYGLLKDEMSEILAKVDEPLNVDGKTPFVILMVGVNG
VGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASV
IFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEDAPHEVMLTIDAST
GQNAVSQARLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPF
KADDFIEALFARED
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggcaaaacagaaaaaacgtggcttcttttcctggctgggctttggtgaaaaagagcag
caggaacaaaaacccgaagaacagcagcttgaagaagaacaacgcccggcagaaacgtcg
gttgacacggcggctgacgtagaagcagaagcgcccgcgcacagcaaagaagagacagaa
acctttgctcaggacgtggttgaagtcacagaacagatccaggagagcgaaaagccgcag
ccggtagagcctgagccggtagcggtagtcgagcctgaacaggtggttgcgccgcaggtc
gccgtcgagcgcgaagtgctgccgctgccggaagaggtgaaagcggaagagacgtcgccg
gaagagtggcaggcggaagcggaaaccgtcgaaattgttaacgcggtggaagaagaggcg
cagaacgtaccgccactgtccgacgaagagctggaagcgcaggcgctggcggcggaagcc
gcggaagaagcggtgctggtggtgccggtagcggaagaggagacgccggtcgacgagatc
gcccaggagcaggaaaaaccgaccaaagagggtttatttgcccggctgaaacgtagcctg
ctgaaaacaaaagagaatctcggttccggatttatcagcctgttccgcggtaaaaaaatc
gatgatgatctgttcgaagagctggaagagcaactgctgattgccgacgtgggcgtggaa
acgacgcgcaaaattatcgccaatctgaccgaaggcgccagccgcaagcagctacgtgat
gccgaagcgctgtacggcctgctgaaagatgagatgagcgagattctggcgaaggttgat
gagccgctgaacgtagacggcaaaacaccgtttgtgattttgatggtgggcgtcaacggc
gtgggtaaaaccaccactatcggcaagctggcgcgtcagttcgagcagcagggcaaatcg
gtgatgctggcggcgggcgataccttccgcgccgcggcggtggagcagcttcaggtctgg
ggccagcgtaataatattccggtgattgcccagcataccggcgcggactccgcatccgtc
atctttgacgctattcaggcggcgaaggcgcgtaacatcgatgtgctgattgctgacacc
gcgggtcgtctgcaaaacaaatcgcacctgatggaagagctgaaaaaaatcgtgcgcgtt
atgaagaaactggatgaggatgcgccgcatgaggttatgctgacaattgacgccagcacc
gggcagaatgcggtaagccaggccagactgttccatgaggcggttggtctgacggggatt
accctgaccaagctggacggcacggcgaaaggcggcgtgatcttctcggtggccgatcag
tttggcattcctatccgctatattggcgtcggcgaacgtatcgaagatttgcgtccgttt
aaggcggacgattttatagaggcactttttgcccgagaggattaa

DBGET integrated database retrieval system