KEGG   Citrobacter rodentium: ROD_44521
Entry
ROD_44521         CDS       T01145                                 
Symbol
crp
Name
(GenBank) cyclic AMP receptor protein (catabolite gene activator)
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
cro  Citrobacter rodentium
Pathway
cro02020  Two-component system
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_44521 (crp)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_44521 (crp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cro03000]
    ROD_44521 (crp)
Transcription factors [BR:cro03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    ROD_44521 (crp)
SSDB
Motif
Pfam: cNMP_binding HTH_Crp_2 Crp HTH_23 RepL MarR_2 MarR HTH_24 Sigma70_r4 HTH_36 HTH_7 HTH_38 HhH-GPD HTH_11 RPA_C
Other DBs
NCBI-ProteinID: CBG91147
UniProt: D2TMD3
LinkDB
Position
complement(4707842..4708474)
AA seq 210 aa
MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEM
ILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSSQ
MARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCS
RETVGRILKMLEDQNLISAHGKTIVVYGTR
NT seq 633 nt   +upstreamnt  +downstreamnt
atggtgcttggcaaaccgcaaacagacccgactctcgaatggttcttgtctcattgccac
attcataagtacccgtcgaagagcacgctgattcaccagggtgaaaaagcggaaacgttg
tattacatcgtgaaaggctcggtagcagtgttgattaaagatgaggaagggaaagaaatg
atcctttcttatctgaatcagggtgattttattggcgaactgggcctgtttgaagaaggc
caggaacgtagcgcatgggtacgagctaaaacagcatgtgaagtggcggaaatttcctac
aagaagttccgtcagctgatccaggtcaacccggatattctgatgcgcctctcttcccag
atggcccgccgcctgcaggtcacctcagaaaaagtcggcaatctggctttccttgacgtg
accgggcgtatcgcccagacgctgctgaatctggcgaaacagccggatgccatgacccac
ccggatggtatgcagatcaaaatcacgcgccaggagattggtcagatcgttggctgctcc
cgcgaaaccgttggtcgtattctgaagatgctggaagatcaaaacctgatctccgcgcac
ggtaagaccatcgtcgtttacggcacgcgttaa

DBGET integrated database retrieval system