KEGG   Citrobacter rodentium: ROD_44951
Entry
ROD_44951         CDS       T01145                                 
Symbol
gspF
Name
(GenBank) putative T2SS protein F
  KO
K02455  general secretion pathway protein F
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_44951 (gspF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_44951 (gspF)
Secretion system [BR:cro02044]
 Type II secretion system
  General secretion pathway protein
   ROD_44951 (gspF)
SSDB
Motif
Pfam: T2SSF Med2 DUF5383 Motilin_ghrelin
Other DBs
NCBI-ProteinID: CBG91190
UniProt: D2TMH6
LinkDB
Position
complement(4749465..4750664)
AA seq 399 aa
MKFSWHATDMQGETVRGVTEANSERDVVAFLRAQGLLPLSIKAQRHALSLSLPGQRISHG
DLTLFTRQLATLIAAALPLDEALAIIQQQKENKKLSSVINGLRLAVLEGQSLSRAMQNHP
RLFDDVFCTLVKAGETVGQLGGVLERLADFNETRQRMRSKLTQALIYPVLLTTVAILVVA
ILLTTVVPKVAAQFLHLKHELPLTTRILLAISDFLSAWGPGLLLFFAALAALFSFWLRRN
GNRLRFHRFLIAFRLTAPLVCAVNSARYLRALSILNNSGVPLLQGMELSAEGVGNLAIRH
RLSEAAESVRQGNSIHRSLAQTEIFPTMMLYMIASGEKSGELGALMQRATENQETHLQNR
IALALAIFEPALIVIMAMIVLFIVVSVMQPILQLNTLMN
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaaatttagctggcacgcaaccgatatgcagggtgagactgtaagaggggtaacggag
gccaacagcgagcgggacgtggtcgcttttttacgcgcgcagggactgttaccgctgtcg
atcaaagcacagcgccacgcgctatccctgtccctgcccggccagcggatcagccacggc
gatttaacgctttttacccgtcagctcgcgacgctgattgccgcggcgctgccgcttgat
gaagcgctggccatcattcagcagcagaaagagaacaaaaagctctcatcagtgatcaac
gggttacgcctggccgtgctggaaggccagtcgctttccagagcaatgcagaaccatccc
cgtctgttcgatgatgtattctgcacgctggtaaaagccggcgaaaccgtcggccagttg
ggcggcgttctcgaacggctggccgattttaatgaaacccgccagaggatgcgtagcaaa
ctgactcaggcgctgatctatcccgtactgctgacgaccgtcgctatcctcgtcgtggcg
atcttactcaccaccgtggtgccgaaggtggcggcacagtttcttcatctcaaacatgaa
ctgccgctgacgacgcgcattctgctggctatcagtgattttctctccgcctggggtccg
gggctcctgctcttcttcgccgcgctggccgccctgttttcattctggctacgacgtaac
ggcaatcgcctgcgttttcatcgtttcctgatcgcattccgcttaaccgcgccgctggtc
tgcgcggtcaacagcgcccgctatttgcgcgcgttgagcattctcaataatagtggcgtc
ccgctgctacaggggatggagctatcggcggaaggggtcggcaatctggctatccgccat
cggcttagcgaagcggcagagagcgtgcgccagggaaacagtattcaccgctcgctggcg
cagacggagatcttccccaccatgatgctttatatgatcgcctcaggggaaaaaagcggc
gagcttggcgcactgatgcagcgggcaacggagaatcaggagactcatctgcagaaccga
atcgctctggcgctggccatcttcgaacccgctctgattgtcatcatggcgatgatcgtt
ctgtttatcgtggtgtccgttatgcaaccgattttgcaactcaatacgttaatgaactaa

DBGET integrated database retrieval system