KEGG   Citrobacter rodentium: ROD_46581
Entry
ROD_46581         CDS       T01145                                 
Symbol
secG
Name
(GenBank) protein-export membrane protein
  KO
K03075  preprotein translocase subunit SecG
Organism
cro  Citrobacter rodentium
Pathway
cro02024  Quorum sensing
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_46581 (secG)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_46581 (secG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_46581 (secG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_46581 (secG)
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_46581 (secG)
SSDB
Motif
Pfam: SecG DUF4870
Other DBs
NCBI-ProteinID: CBG91353
UniProt: D2TPC0
LinkDB
Position
4912819..4913199
AA seq 126 aa
MVEALVRGNSARNRLIMYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFG
SSGSGNFMTRMTALLATLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAQP
TSDIPQ
NT seq 381 nt   +upstreamnt  +downstreamnt
ttggttgaagcattggtacgcggcaactccgcaaggaacaggttgattatgtacgaagct
cttttggtagttttccttattgtggcaattggcttggtgggtctgattatgctgcagcaa
ggtaaaggcgctgatatgggagcctccttcggagcaggcgcttccgctacgctgtttggt
tcaagtggttctggtaacttcatgacccgcatgacggctttgctggcgaccttgttcttc
atcatcagtctggtgctgggtaatatcaacagcaacaagaccaataaaggaagtgagtgg
gaaaacctgagcgcgccggcgaagaccgagcagactcagccagctgctccggctcagccg
accagcgatatcccgcagtaa

DBGET integrated database retrieval system