Citrobacter rodentium: ROD_46581 Help Entry ROD_46581         CDS       T01145                                  Symbol secG Name (GenBank) protein-export membrane protein   KO K03075   preprotein translocase subunit SecG Organism cro  Citrobacter rodentium Pathway cro02024   Quorum sensing cro03060   Protein export cro03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:cro00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     ROD_46581 (secG)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     ROD_46581 (secG)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ROD_46581 (secG)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cro02044]     ROD_46581 (secG) Secretion system [BR:cro02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    ROD_46581 (secG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecG Motif Other DBs NCBI-ProteinID:  CBG91353 UniProt:  D2TPC0 LinkDB All DBs Position 4912819..4913199 Genome browser AA seq 126 aa AA seqDB search MVEALVRGNSARNRLIMYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFG SSGSGNFMTRMTALLATLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAQP TSDIPQ NT seq 381 nt NT seq  +upstreamnt  +downstreamnt ttggttgaagcattggtacgcggcaactccgcaaggaacaggttgattatgtacgaagct cttttggtagttttccttattgtggcaattggcttggtgggtctgattatgctgcagcaa ggtaaaggcgctgatatgggagcctccttcggagcaggcgcttccgctacgctgtttggt tcaagtggttctggtaacttcatgacccgcatgacggctttgctggcgaccttgttcttc atcatcagtctggtgctgggtaatatcaacagcaacaagaccaataaaggaagtgagtgg gaaaacctgagcgcgccggcgaagaccgagcagactcagccagctgctccggctcagccg accagcgatatcccgcagtaa

DBGET integrated database retrieval system